Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T86679
|
||||
| Former ID |
TTDS00188
|
||||
| Target Name |
Adenosine A2b receptor
|
||||
| Gene Name |
ADORA2B
|
||||
| Synonyms |
A2b Adenosine receptor; Adenosine receptor A2b; ADORA2B
|
||||
| Target Type |
Successful
|
||||
| Disease | Asthma [ICD10: J45] | ||||
| Apnea [ICD9: 786.03; ICD10: R06.81] | |||||
| Hypertension [ICD9: 401; ICD10: I10-I16] | |||||
| Herpes simplex virus infection [ICD9: 54; ICD10: B00] | |||||
| Multiple scierosis [ICD9: 340; ICD10: G35] | |||||
| Non-insulin dependent diabetes [ICD10: E11.9] | |||||
| Parkinson's disease [ICD9: 332; ICD10: G20] | |||||
| Paroxysmal supraventricular tachycardia [ICD9: 427, 427.0, 427.1, 427.89, 785.0; ICD10: I47-I49, I47.1, I47.2, R00.0] | |||||
| Function |
Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T86679
|
||||
| UniProt ID | |||||
| Sequence |
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA
IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT FHKIISRYLLCQADVKSGNGQAGVQPALGVGL |
||||
| Structure |
1MMH; 1UPE; 2YDO; 2YDV; 3EML; 3PWH; 3QAK; 3REY; 3RFM; 3UZA; 3UZC; 3VG9; 3VGA; 4EIY
|
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Adenosine | Drug Info | Approved | Paroxysmal supraventricular tachycardia | [536838], [539879] |
| Vidarabine | Drug Info | Approved | Herpes simplex virus infection | [468037], [538596] | |
| Tonapofylline | Drug Info | Phase 2/3 | Discovery agent | [522369], [540973] | |
| YT-146 | Drug Info | Phase 2 | Hypertension | [544864] | |
| CVT-6883 | Drug Info | Phase 1 | Asthma | [532020], [540984] | |
| KF-17837 | Drug Info | Phase 1 | Parkinson's disease | [546031] | |
| Xanthine | Drug Info | Phase 1 | Apnea | [467794], [527315] | |
| LAS-101057 | Drug Info | Preclinical | Asthma | [540986], [548701] | |
| METHYLTHIOADENOSINE | Drug Info | Terminated | Multiple scierosis | [544778] | |
| ZM-241385 | Drug Info | Terminated | Discovery agent | [540649], [546100] | |
| Inhibitor | (1H-Imidazo[4,5-c]quinolin-4-yl)-phenyl-amine HCl | Drug Info | [530590] | ||
| 1,3-Diallyl-3,7-dihydro-purine-2,6-dione | Drug Info | [533429] | |||
| 1,3-Diethyl-3,7-dihydro-purine-2,6-dione | Drug Info | [533429] | |||
| 1,3-Dipropyl-3,7-dihydro-purine-2,6-dione | Drug Info | [533429] | |||
| 1-Benzyl-3-methyl-3,7-dihydro-purine-2,6-dione | Drug Info | [526332] | |||
| 1-Butyl-8-phenyl-3,7-dihydro-purine-2,6-dione | Drug Info | [526958] | |||
| 1-METHYLXANTHINE | Drug Info | [533429] | |||
| 1-Propyl-3,7-dihydro-purine-2,6-dione | Drug Info | [526332] | |||
| 1H-Imidazo[4,5-c]quinolin-4-ylamine HCl | Drug Info | [530590] | |||
| 2'-Me-tecadenoson | Drug Info | [529098] | |||
| 2,5'-dichloro-5'-deoxy-N6-cyclopentyladenosine | Drug Info | [530035] | |||
| 2,6-diphenyl-8-(1-ethylpropyl)-1-deazapurine | Drug Info | [528673] | |||
| 2-(6-amino-8-bromo-9H-purin-9-yl)ethanol | Drug Info | [530966] | |||
| 2-Amino-4,6-di-furan-2-yl-nicotinonitrile | Drug Info | [529602] | |||
| 2-Amino-4-furan-2-yl-6-phenyl-nicotinonitrile | Drug Info | [529602] | |||
| 2-Amino-6-furan-2-yl-4-phenyl-nicotinonitrile | Drug Info | [529602] | |||
| 2-chloro-2'-C-methyl-tecadenoson | Drug Info | [529098] | |||
| 2-chloro-N6-cyclopentyladenosine | Drug Info | [529098] | |||
| 2-Cyclopentyl-1H-imidazo[4,5-c]quinolin-4-ylamine | Drug Info | [530590] | |||
| 2-ethyl-4-(thiazol-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [529419] | |||
| 2-Phenyl-1H-imidazo[4,5-c]quinolin-4-ylamine | Drug Info | [530590] | |||
| 3-Isobutyl-1-methyl-3,9-dihydro-purine-2,6-dione | Drug Info | [533542] | |||
| 3-Methyl-1-phenethyl-3,7-dihydro-purine-2,6-dione | Drug Info | [526332] | |||
| 3-noradamantyl-1,3-dipropylxanthine | Drug Info | [528544] | |||
| 8-(3-Fluoro-phenyl)-9-methyl-9H-purin-6-ylamine | Drug Info | [525962] | |||
| 8-Bromo-9-(2,3-dihydroxypropyl)-9H-adenine | Drug Info | [530014] | |||
| 8-Bromo-9-(2-butyl)-9H-adenine | Drug Info | [530014] | |||
| 8-Bromo-9-(2-hydroxypropyl)-9H-adenine | Drug Info | [530014] | |||
| 8-Bromo-9-(3-hydroxypropyl)-9H-adenine | Drug Info | [530014] | |||
| 8-Bromo-9-(sec-butyl)-9H-adenine | Drug Info | [530014] | |||
| 8-Bromo-9-cyclobutyl-9H-adenine | Drug Info | [530014] | |||
| 8-Bromo-9-cyclopentyl-9H-adenine | Drug Info | [530014] | |||
| 8-Bromo-9-ethyl-9H-adenine | Drug Info | [530014] | |||
| 8-bromo-9-isobutyl-9H-purin-6-amine | Drug Info | [530966] | |||
| 8-Bromo-9-isopropyl-9H-adenine | Drug Info | [530014] | |||
| 8-Bromo-9-methyl-9H-adenine | Drug Info | [530014] | |||
| 8-Bromo-9-propyl-9H-adenine | Drug Info | [530014] | |||
| 8-PHENYL THEOPHYLLINE | Drug Info | [525962] | |||
| 8-Phenyl-1-propyl-3,7-dihydro-purine-2,6-dione | Drug Info | [526958] | |||
| 9-(sec-Butyl)-9H-adenine | Drug Info | [530014] | |||
| 9-Allyl-8-bromo-9H-adenine | Drug Info | [530014] | |||
| 9-Cyclobutyl-9H-adenine | Drug Info | [530014] | |||
| 9-Isopropyl-9H-adenine | Drug Info | [530014] | |||
| 9-Propyl-9H-adenine | Drug Info | [530014] | |||
| ALLOXAZINE | Drug Info | [527823] | |||
| BETA-HYDROXYETHYL THEOPHYLLINE | Drug Info | [530966] | |||
| CVT-6694 | Drug Info | [530966] | |||
| CVT-7124 | Drug Info | [530966] | |||
| Ethyl 5-benzoyl-4-phenylthiazol-2-ylcarbamate | Drug Info | [530752] | |||
| GNF-PF-2224 | Drug Info | [551303] | |||
| GNF-PF-2700 | Drug Info | [530966] | |||
| ISOGUANOSINE | Drug Info | [551229] | |||
| KF-17837 | Drug Info | [533955] | |||
| LUF-5816 | Drug Info | [528673] | |||
| LUF-5978 | Drug Info | [528673] | |||
| LUF-5980 | Drug Info | [528673] | |||
| LUF-5981 | Drug Info | [528673] | |||
| METHYLTHIOADENOSINE | Drug Info | [527040] | |||
| N-(2-(furan-2-yl)-3,4'-bipyridin-6-yl)acetamide | Drug Info | [530694] | |||
| N6-((+/-)-endo-norborn-2-yl)adenosine | Drug Info | [530035] | |||
| N6-CYCLOPENTYLADENOSINE | Drug Info | [533449] | |||
| NECA | Drug Info | [533449] | |||
| OSIP-339391 | Drug Info | [530966] | |||
| PD-115199 | Drug Info | [527717] | |||
| PSB-0788 | Drug Info | [530243] | |||
| PSB-09120 | Drug Info | [530243] | |||
| PSB-1115 | Drug Info | [530243] | |||
| PSB-601 | Drug Info | [530966] | |||
| SB-298 | Drug Info | [530243] | |||
| ST-1535 | Drug Info | [527823] | |||
| Tonapofylline | Drug Info | [530752] | |||
| ZM-241385 | Drug Info | [530768] | |||
| Agonist | (R)-PIA | Drug Info | [533531] | ||
| (R,S)-PHPNECA | Drug Info | [526375] | |||
| (S)-PIA | Drug Info | [525595] | |||
| 2-chloroadenosine | Drug Info | [533531] | |||
| AB-MECA | Drug Info | [534553] | |||
| AB-NECA | Drug Info | [525595] | |||
| APNEA | Drug Info | [534821] | |||
| BAY 60-6583 | Drug Info | [528730] | |||
| CGS 24012 | Drug Info | [533734] | |||
| CV-1674 | Drug Info | [534821] | |||
| CV-1808 | Drug Info | [534396] | |||
| HEMADO | Drug Info | [528546] | |||
| MRS5151 | Drug Info | [529435] | |||
| N(6)-cyclohexyladenosine | Drug Info | [533531] | |||
| PENECA | Drug Info | [526375] | |||
| TCPA | Drug Info | [534519] | |||
| YT-146 | Drug Info | [533910] | |||
| [3H]CGS 21680 | Drug Info | [533253] | |||
| [3H]NECA | Drug Info | [534553] | |||
| Antagonist | 3-isobutyl-8-pyrrolidinoxanthine | Drug Info | [526188] | ||
| Adenosine A2b antagonists | Drug Info | [543534] | |||
| AS100 | Drug Info | [527796] | |||
| AS16 | Drug Info | [527796] | |||
| AS70 | Drug Info | [527796] | |||
| AS74 | Drug Info | [527796] | |||
| AS94 | Drug Info | [527796] | |||
| AS95 | Drug Info | [527796] | |||
| AS96 | Drug Info | [527796] | |||
| AS99 | Drug Info | [527796] | |||
| ATL-801 | Drug Info | [543534] | |||
| ATL-844 | Drug Info | [543534] | |||
| ATL802 | Drug Info | [525731] | |||
| CPFPX | Drug Info | [526448] | |||
| CSC | Drug Info | [543534] | |||
| DEPX | Drug Info | [525595] | |||
| flavone | Drug Info | [534145] | |||
| I-ABOPX | Drug Info | [525595] | |||
| KF 17837S | Drug Info | [534396] | |||
| KF26777 | Drug Info | [526356] | |||
| LAS-101057 | Drug Info | [532805] | |||
| MRE 2029F20 | Drug Info | [526981] | |||
| MRE 3008F20 | Drug Info | [528068] | |||
| MRS1041 | Drug Info | [534145] | |||
| MRS1042 | Drug Info | [534145] | |||
| MRS1065 | Drug Info | [534145] | |||
| MRS1066 | Drug Info | [534145] | |||
| MRS1084 | Drug Info | [534145] | |||
| MRS1086 | Drug Info | [534145] | |||
| MRS1088 | Drug Info | [534145] | |||
| MRS1093 | Drug Info | [534145] | |||
| MRS1132 | Drug Info | [534145] | |||
| MRS1191 | Drug Info | [543534] | |||
| MRS1523 | Drug Info | [543534] | |||
| MRS1706 | Drug Info | [525731] | |||
| MRS923 | Drug Info | [534145] | |||
| MRS928 | Drug Info | [534145] | |||
| PSB-10 | Drug Info | [526390] | |||
| PSB-11 | Drug Info | [526390] | |||
| PSB36 | Drug Info | [528011] | |||
| PSB603 | Drug Info | [530243] | |||
| sakuranetin | Drug Info | [534145] | |||
| visnagin | Drug Info | [534145] | |||
| VUF5574 | Drug Info | [534717] | |||
| Xanthine | Drug Info | [535254] | |||
| xanthine amine congener | Drug Info | [525667] | |||
| XCC | Drug Info | [526013] | |||
| [125I]ABOPX | Drug Info | [525595] | |||
| [125I]ZM-241385 | Drug Info | [534233] | |||
| [3H]DPCPX | Drug Info | [527107] | |||
| [3H]MRS1754 | Drug Info | [526013] | |||
| [3H]OSIP339391 | Drug Info | [527107] | |||
| [3H]PSB603 | Drug Info | [530243] | |||
| [3H]SCH 58261 | Drug Info | [534821] | |||
| [3H]XAC | Drug Info | [533734] | |||
| [3H]ZM 241385 | Drug Info | [525667] | |||
| Modulator | Adenosine | Drug Info | [556264] | ||
| CVT-6883 | Drug Info | [532020] | |||
| Vidarabine | Drug Info | [556264] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Rap1 signaling pathway | ||||
| Calcium signaling pathway | |||||
| Neuroactive ligand-receptor interaction | |||||
| Vascular smooth muscle contraction | |||||
| Alcoholism | |||||
| NetPath Pathway | TGF_beta_Receptor Signaling Pathway | ||||
| TCR Signaling Pathway | |||||
| Pathway Interaction Database | C-MYB transcription factor network | ||||
| PathWhiz Pathway | Intracellular Signalling Through Adenosine Receptor A2b and Adenosine | ||||
| Reactome | Adenosine P1 receptors | ||||
| G alpha (s) signalling events | |||||
| Surfactant metabolism | |||||
| WikiPathways | Nucleotide GPCRs | ||||
| GPCRs, Class A Rhodopsin-like | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| References | |||||
| Ref 467794 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4557). | ||||
| Ref 468037 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4806). | ||||
| Ref 522369 | ClinicalTrials.gov (NCT00709865) Phase 2b Study to Assess the Safety and Tolerability of IV Tonapofylline in Subjects With Acute Decompensated Heart Failure (ADHF) and Renal Insufficiency. U.S. National Institutes of Health. | ||||
| Ref 527315 | Febuxostat (TMX-67), a novel, non-purine, selective inhibitor of xanthine oxidase, is safe and decreases serum urate in healthy volunteers. Nucleosides Nucleotides Nucleic Acids. 2004 Oct;23(8-9):1111-6. | ||||
| Ref 532020 | GS-6201, a selective blocker of the A2B adenosine receptor, attenuates cardiac remodeling after acute myocardial infarction in the mouse. J Pharmacol Exp Ther. 2012 Dec;343(3):587-95. | ||||
| Ref 536838 | Emerging drugs for chemotherapy-induced mucositis. Expert Opin Emerg Drugs. 2008 Sep;13(3):511-22. | ||||
| Ref 538596 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 050486. | ||||
| Ref 539879 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2844). | ||||
| Ref 540649 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 405). | ||||
| Ref 540973 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5605). | ||||
| Ref 540984 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5615). | ||||
| Ref 540986 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5617). | ||||
| Ref 544778 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000987) | ||||
| Ref 544864 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001363) | ||||
| Ref 546031 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005980) | ||||
| Ref 525595 | Characterization of human A(2B) adenosine receptors: radioligand binding, western blotting, and coupling to G(q) in human embryonic kidney 293 cells and HMC-1 mast cells. Mol Pharmacol. 1999 Oct;56(4):705-13. | ||||
| Ref 525667 | Use of the triazolotriazine [3H]ZM 241385 as a radioligand at recombinant human A2B adenosine receptors. Drug Des Discov. 1999 Nov;16(3):217-26. | ||||
| Ref 525731 | Anilide derivatives of an 8-phenylxanthine carboxylic congener are highly potent and selective antagonists at human A(2B) adenosine receptors. J Med Chem. 2000 Mar 23;43(6):1165-72. | ||||
| Ref 525962 | J Med Chem. 2001 Jan 18;44(2):170-9.2-Alkynyl-8-aryl-9-methyladenines as novel adenosine receptor antagonists: their synthesis and structure-activity relationships toward hepatic glucose production induced via agonism of the A(2B) receptor. | ||||
| Ref 526013 | [3H]MRS 1754, a selective antagonist radioligand for A(2B) adenosine receptors. Biochem Pharmacol. 2001 Mar 15;61(6):657-63. | ||||
| Ref 526188 | Inhibition of human mast cell activation with the novel selective adenosine A(2B) receptor antagonist 3-isobutyl-8-pyrrolidinoxanthine (IPDX)(2). Biochem Pharmacol. 2001 Nov 1;62(9):1163-73. | ||||
| Ref 526332 | J Med Chem. 2002 May 23;45(11):2131-8.Structure-activity relationships at human and rat A2B adenosine receptors of xanthine derivatives substituted at the 1-, 3-, 7-, and 8-positions. | ||||
| Ref 526356 | KF26777 (2-(4-bromophenyl)-7,8-dihydro-4-propyl-1H-imidazo[2,1-i]purin-5(4H)-one dihydrochloride), a new potent and selective adenosine A3 receptor antagonist. Eur J Pharmacol. 2002 May 31;444(3):133-41. | ||||
| Ref 526375 | N(6)-alkyl-2-alkynyl derivatives of adenosine as potent and selective agonists at the human adenosine A(3) receptor and a starting point for searching A(2B) ligands. J Med Chem. 2002 Jul 18;45(15):3271-9. | ||||
| Ref 526390 | Imidazo[2,1-i]purin-5-ones and related tricyclic water-soluble purine derivatives: potent A(2A)- and A(3)-adenosine receptor antagonists. J Med Chem. 2002 Aug 1;45(16):3440-50. | ||||
| Ref 526448 | Synthesis and evaluation of no-carrier-added 8-cyclopentyl-3-(3-[(18)F]fluoropropyl)-1-propylxanthine ([(18)F]CPFPX): a potent and selective A(1)-adenosine receptor antagonist for in vivo imaging. J Med Chem. 2002 Nov 7;45(23):5150-6. | ||||
| Ref 526958 | J Med Chem. 2004 Feb 12;47(4):1031-43.Preparation, properties, reactions, and adenosine receptor affinities of sulfophenylxanthine nitrophenyl esters: toward the development of sulfonic acid prodrugswith peroral bioavailability. | ||||
| Ref 526981 | Design, synthesis, and biological evaluation of new 8-heterocyclic xanthine derivatives as highly potent and selective human A2B adenosine receptor antagonists. J Med Chem. 2004 Mar 11;47(6):1434-47. | ||||
| Ref 527040 | J Med Chem. 2004 Apr 22;47(9):2243-55.Novel amino acid derived natural products from the ascidian Atriolum robustum: identification and pharmacological characterization of a unique adenosine derivative. | ||||
| Ref 527107 | [3H]OSIP339391, a selective, novel, and high affinity antagonist radioligand for adenosine A2B receptors. Biochem Pharmacol. 2004 Jul 15;68(2):305-12. | ||||
| Ref 527717 | J Med Chem. 1992 Jun 12;35(12):2342-5.(E)-1,3-dialkyl-7-methyl-8-(3,4,5-trimethoxystyryl)xanthines: potent and selective adenosine A2 antagonists. | ||||
| Ref 527796 | Pharmacological characterization of novel adenosine ligands in recombinant and native human A2B receptors. Biochem Pharmacol. 2005 Nov 25;70(11):1601-12. Epub 2005 Oct 10. | ||||
| Ref 527823 | J Med Chem. 2005 Nov 3;48(22):6887-96.2-n-Butyl-9-methyl-8-[1,2,3]triazol-2-yl-9H-purin-6-ylamine and analogues as A2A adenosine receptor antagonists. Design, synthesis, and pharmacological characterization. | ||||
| Ref 528011 | Norbornyllactone-substituted xanthines as adenosine A(1) receptor antagonists. Bioorg Med Chem. 2006 Jun 1;14(11):3654-61. Epub 2006 Feb 2. | ||||
| Ref 528544 | J Med Chem. 2006 Nov 30;49(24):7119-31.Potent and orally bioavailable 8-bicyclo[2.2.2]octylxanthines as adenosine A1 receptor antagonists. | ||||
| Ref 528546 | [3H]HEMADO--a novel tritiated agonist selective for the human adenosine A3 receptor. Eur J Pharmacol. 2007 Feb 5;556(1-3):14-8. Epub 2006 Oct 27. | ||||
| Ref 528673 | J Med Chem. 2007 Feb 22;50(4):828-34.2,6,8-trisubstituted 1-deazapurines as adenosine receptor antagonists. | ||||
| Ref 528730 | Cardioprotection by ecto-5'-nucleotidase (CD73) and A2B adenosine receptors. Circulation. 2007 Mar 27;115(12):1581-90. Epub 2007 Mar 12. | ||||
| Ref 529098 | Bioorg Med Chem. 2008 Jan 1;16(1):336-53. Epub 2007 Sep 22.5'-Carbamoyl derivatives of 2'-C-methyl-purine nucleosides as selective A1 adenosine receptor agonists: affinity, efficacy, and selectivityfor A1 receptor from different species. | ||||
| Ref 529419 | Bioorg Med Chem Lett. 2008 May 1;18(9):2920-3. Epub 2008 Mar 30.Antagonists of the human adenosine A2A receptor. Part 2: Design and synthesis of 4-arylthieno[3,2-d]pyrimidine derivatives. | ||||
| Ref 529435 | Design of (N)-methanocarba adenosine 5'-uronamides as species-independent A3 receptor-selective agonists. Bioorg Med Chem Lett. 2008 May 1;18(9):2813-9. | ||||
| Ref 529602 | J Med Chem. 2008 Aug 14;51(15):4449-55. Epub 2008 Jul 19.2-Amino-6-furan-2-yl-4-substituted nicotinonitriles as A2A adenosine receptor antagonists. | ||||
| Ref 530014 | Bioorg Med Chem. 2009 Apr 1;17(7):2812-22. Epub 2009 Feb 23.8-Bromo-9-alkyl adenine derivatives as tools for developing new adenosine A2A and A2B receptors ligands. | ||||
| Ref 530035 | J Med Chem. 2009 Apr 23;52(8):2393-406.N6-Cycloalkyl- and N6-bicycloalkyl-C5'(C2')-modified adenosine derivatives as high-affinity and selective agonists at the human A1 adenosine receptor with antinociceptive effects in mice. | ||||
| Ref 530243 | J Med Chem. 2009 Jul 9;52(13):3994-4006.1-alkyl-8-(piperazine-1-sulfonyl)phenylxanthines: development and characterization of adenosine A2B receptor antagonists and a new radioligand with subnanomolar affinity and subtype specificity. | ||||
| Ref 530590 | J Med Chem. 1991 Mar;34(3):1202-6.1H-imidazo[4,5-c]quinolin-4-amines: novel non-xanthine adenosine antagonists. | ||||
| Ref 530694 | Bioorg Med Chem Lett. 2010 Mar 1;20(5):1697-700. Epub 2010 Jan 20.Discovery of N-(5,6-diarylpyridin-2-yl)amide derivatives as potent and selective A(2B) adenosine receptor antagonists. | ||||
| Ref 530752 | Bioorg Med Chem. 2010 Mar 15;18(6):2195-203. Epub 2010 Feb 4.2-Amino-5-benzoyl-4-phenylthiazoles: Development of potent and selective adenosine A1 receptor antagonists. | ||||
| Ref 530768 | Bioorg Med Chem. 2010 Mar 15;18(6):2081-8. Epub 2010 Feb 15.Synthesis of theophylline derivatives and study of their activity as antagonists at adenosine receptors. | ||||
| Ref 530966 | Eur J Med Chem. 2010 Aug;45(8):3459-71. Epub 2010 May 7.Insights into binding modes of adenosine A(2B) antagonists with ligand-based and receptor-based methods. | ||||
| Ref 532020 | GS-6201, a selective blocker of the A2B adenosine receptor, attenuates cardiac remodeling after acute myocardial infarction in the mouse. J Pharmacol Exp Ther. 2012 Dec;343(3):587-95. | ||||
| Ref 532805 | Discovery of LAS101057: A Potent, Selective, and Orally Efficacious A2B Adenosine Receptor Antagonist. ACS Med Chem Lett. 2010 Dec 20;2(3):213-8. | ||||
| Ref 533253 | [3H]CGS 21680, a selective A2 adenosine receptor agonist directly labels A2 receptors in rat brain. J Pharmacol Exp Ther. 1989 Dec;251(3):888-93. | ||||
| Ref 533429 | J Med Chem. 1988 Oct;31(10):2034-9.Benzo[1,2-c:5,4-c']dipyrazoles: non-xanthine adenosine antagonists. | ||||
| Ref 533449 | J Med Chem. 1988 Jun;31(6):1179-83.Adenosine receptor agonists: synthesis and biological evaluation of 1-deaza analogues of adenosine derivatives. | ||||
| Ref 533531 | Adenosine receptor activation in human fibroblasts: nucleoside agonists and antagonists. Can J Physiol Pharmacol. 1980 Jun;58(6):673-91. | ||||
| Ref 533734 | Site-directed mutagenesis identifies residues involved in ligand recognition in the human A2a adenosine receptor. J Biol Chem. 1995 Jun 9;270(23):13987-97. | ||||
| Ref 533910 | Identification of adenosine A2 receptor-cAMP system in human aortic endothelial cells. Biochem Biophys Res Commun. 1994 Mar 15;199(2):905-10. | ||||
| Ref 533955 | J Med Chem. 1993 Nov 12;36(23):3731-3.Photoisomerization of a potent and selective adenosine A2 antagonist, (E)-1,3-Dipropyl-8-(3,4-dimethoxystyryl)-7-methylxanthine. | ||||
| Ref 534145 | J Med Chem. 1996 Jun 7;39(12):2293-301.Synthesis and biological activities of flavonoid derivatives as A3 adenosine receptor antagonists. | ||||
| Ref 534233 | 125I-4-(2-[7-amino-2-[2-furyl][1,2,4]triazolo[2,3-a][1,3,5] triazin-5-yl-amino]ethyl)phenol, a high affinity antagonist radioligand selective for the A2a adenosine receptor. Mol Pharmacol. 1995 Dec;48(6):970-4. | ||||
| Ref 534396 | Characterization of human A2A adenosine receptors with the antagonist radioligand [3H]-SCH 58261. Br J Pharmacol. 1997 Jun;121(3):353-60. | ||||
| Ref 534519 | Heterologous expression of rat epitope-tagged histamine H2 receptors in insect Sf9 cells. Br J Pharmacol. 1997 Nov;122(5):867-74. | ||||
| Ref 534553 | Comparative pharmacology of human adenosine receptor subtypes - characterization of stably transfected receptors in CHO cells. Naunyn Schmiedebergs Arch Pharmacol. 1998 Jan;357(1):1-9. | ||||
| Ref 534717 | J Med Chem. 1998 Oct 8;41(21):3987-93.A novel class of adenosine A3 receptor ligands. 1. 3-(2-Pyridinyl)isoquinoline derivatives. | ||||
| Ref 534821 | Differences in the order of potency for agonists but not antagonists at human and rat adenosine A2A receptors. Biochem Pharmacol. 1999 Jan 1;57(1):65-75. | ||||
| Ref 543534 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 20). | ||||
| Ref 551229 | High selectivity of novel isoguanosine analogues for the adenosine A1 receptor. Bioorg. Med. Chem. Lett. 1(9):481-486 (1991). | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
