Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T60857
|
||||
| Former ID |
TTDR00033
|
||||
| Target Name |
Aldo-keto reductase family 1 member C3
|
||||
| Gene Name |
AKR1C3
|
||||
| Synonyms |
3-alpha-hydroxysteroid dehydrogenase; 3alpha-HSD; Chlordecone reductase homolog HAKRb; DD3; Dihydrodiol dehydrogenase 3; Dihydrodiol dehydrogenase, type I; HA1753; HPGFS; Human prostaglandin F synthase; Prostaglandin F synthase; Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; AKR1C3
|
||||
| Target Type |
Successful
|
||||
| Disease | Dysmenorrhea [ICD9: 625.3; ICD10: N94.4-N94.6] | ||||
| Prostate cancer [ICD9: 185; ICD10: C61] | |||||
| Function |
Catalyzes the conversion of aldehydes and ketones to alcohols. Catalyzes the reduction of prostaglandin (pg) d2, pgh2 and phenanthrenequinone (pq) and the oxidation of 9alpha,11beta- pgf2 to pgd2.
|
||||
| BioChemical Class |
Short-chain dehydrogenases reductases
|
||||
| Target Validation |
T60857
|
||||
| UniProt ID | |||||
| EC Number |
EC 1.3.1.20
|
||||
| Sequence |
MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPM SLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPV LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD RNLHYFNSDSFASHPNYPYSDEY |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | 2'-Monophosphoadenosine 5'-Diphosphoribose | Drug Info | [551393] | ||
| 2,2-Dibenzylcyclopentanol | Drug Info | [529980] | |||
| 2-(4-Chlorobenzylidene)cyclopentanone | Drug Info | [529980] | |||
| 2-(4-chlorobenzylidene)cyclopentyl ethyl ether | Drug Info | [529980] | |||
| 2-(4-chlorobenzylidene)cyclopentylmethyl ether | Drug Info | [529980] | |||
| 2-Methyl-2,4-Pentanediol | Drug Info | [551393] | |||
| 2-[(2,2-diphenylacetyl)amino]benzoic acid | Drug Info | [527759] | |||
| 3-Bromo-5-phenylsalicylc acid | Drug Info | [530095] | |||
| 3-Phenylcyclopentanecarboxylic acid | Drug Info | [529980] | |||
| 4-ANDROSTENE-3-17-DIONE | Drug Info | [551374] | |||
| Acetate Ion | Drug Info | [551393] | |||
| EM-1424 | Drug Info | [528576] | |||
| EM1396 | Drug Info | [528576] | |||
| Flufenamic Acid | Drug Info | [551392] | |||
| M-Phenoxybenzoic Acid For Cis-Isomer | Drug Info | [527759] | |||
| Rutin | Drug Info | [551393] | |||
| Agonist | 4-Androstenedione | Drug Info | [551393] | ||
| Modulator | ASP-9521 | Drug Info | [532753], [532866] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| BioCyc Pathway | Superpathway of steroid hormone biosynthesis | ||||
| Allopregnanolone biosynthesis | |||||
| Androgen biosynthesis | |||||
| KEGG Pathway | Steroid hormone biosynthesis | ||||
| Arachidonic acid metabolism | |||||
| Metabolic pathways | |||||
| Ovarian steroidogenesis | |||||
| NetPath Pathway | TGF_beta_Receptor Signaling Pathway | ||||
| PathWhiz Pathway | Arachidonic Acid Metabolism | ||||
| Reactome | Retinoid metabolism and transport | ||||
| WikiPathways | Metapathway biotransformation | ||||
| Benzo(a)pyrene metabolism | |||||
| Arachidonic acid metabolism | |||||
| References | |||||
| Ref 523469 | ClinicalTrials.gov (NCT01352208) Phase I/II Study of ASP9521 in Castrate-Resistant Prostate Cancer (CRPC) Patients. U.S. National Institutes of Health. | ||||
| Ref 527759 | Bioorg Med Chem Lett. 2005 Dec 1;15(23):5170-5. Epub 2005 Sep 23.Nonsteroidal anti-inflammatory drugs and their analogues as inhibitors of aldo-keto reductase AKR1C3: new lead compounds for the development of anticancer agents. | ||||
| Ref 528576 | J Biol Chem. 2007 Mar 16;282(11):8368-79. Epub 2006 Dec 13.Structure-based inhibitor design for an enzyme that binds different steroids: a potent inhibitor for human type 5 17beta-hydroxysteroid dehydrogenase. | ||||
| Ref 529980 | Eur J Med Chem. 2009 Jun;44(6):2563-71. Epub 2009 Feb 5.New cyclopentane derivatives as inhibitors of steroid metabolizing enzymes AKR1C1 and AKR1C3. | ||||
| Ref 530095 | J Med Chem. 2009 May 28;52(10):3259-64.Structure-guided design, synthesis, and evaluation of salicylic acid-based inhibitors targeting a selectivity pocket in the active site of human 20alpha-hydroxysteroid dehydrogenase (AKR1C1). | ||||
| Ref 532753 | Safety, tolerability and anti-tumour activity of the androgen biosynthesis inhibitor ASP9521 in patients with metastatic castration-resistant prostate cancer: multi-centre phase I/II study. Invest New Drugs. 2014 Oct;32(5):995-1004. | ||||
| Ref 532866 | In vitro and in vivo characterisation of ASP9521: a novel, selective, orally bioavailable inhibitor of 17beta-hydroxysteroid dehydrogenase type 5 (17betaHSD5; AKR1C3). Invest New Drugs. 2014 Oct;32(5):860-70. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
