Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T07173
|
||||
| Former ID |
TTDC00318
|
||||
| Target Name |
Neurotrophic tyrosine kinase receptor 1
|
||||
| Gene Name |
NTRK1
|
||||
| Synonyms |
NGF-trk receptor type A; P140-TrkA; TRK1 transforming tyrosinekinase protein; Trk-A; NTRK1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Advanced solid malignancies [ICD9: 140-199, 140-239, 210-229; ICD10: D10-D36, D3A] | ||||
| Alzheimer disease [ICD9: 331; ICD10: G30] | |||||
| Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
| Psoriasis [ICD9: 696; ICD10: L40] | |||||
| Pancreatic cancer [ICD9: 140-199, 140-229, 157, 210-229; ICD10: C25] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
Required for high-affinitybinding to nerve growth factor (ngf), neurotrophin-3 and neurotrophin-4/5 but not brain- derived neurotrophic factor (bdnf). Known substrates for the trk receptors are shc, pi-3 kinase, and plc-gamma-1.
|
||||
| BioChemical Class |
Kinase
|
||||
| Target Validation |
T07173
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.10.1
|
||||
| Sequence |
MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLH
HLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRL NLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQ GPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMK SGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWC IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYT LLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSV AVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTE GKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKML VAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRF LRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQ GLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEI FTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHAR LQALAQAPPVYLDVLG |
||||
| Structure |
1HE7; 1SHC; 1WWA; 1WWW; 2IFG; 4AOJ; 4CRP; 4F0I; 4GT5; 4PMM; 4PMP; 4PMS; 4PMT
|
||||
| Drugs and Mode of Action | |||||
| Drug(s) | MIM-D3 | Drug Info | Phase 3 | Alzheimer disease | [524465] |
| CT 327 | Drug Info | Phase 2 | Psoriasis | [524232] | |
| RXDX 101 | Drug Info | Phase 1/2 | Solid tumours | [532994] | |
| DS-6051 | Drug Info | Phase 1 | Solid tumours | [524973] | |
| LOXO-101 | Drug Info | Phase 1 | Solid tumours | [524734] | |
| PLX7486 | Drug Info | Phase 1 | Pancreatic cancer | [549504] | |
| FX-007 | Drug Info | Preclinical | Pain | [549432] | |
| AZD6918 | Drug Info | Discontinued in Phase 1 | Advanced solid malignancies | [548789] | |
| Inhibitor | AZD6918 | Drug Info | [550288] | ||
| CEP-5104 | Drug Info | [529647] | |||
| CEP-6331 | Drug Info | [529647] | |||
| CT 327 | Drug Info | [525414] | |||
| DS-6051 | Drug Info | [550518] | |||
| FX-007 | Drug Info | [550350] | |||
| GW-5074 | Drug Info | [526991] | |||
| K-252a analogue | Drug Info | [527569] | |||
| LOXO-101 | Drug Info | [551954] | |||
| PLX7486 | Drug Info | [550497] | |||
| RXDX 101 | Drug Info | [543043] | |||
| Agonist | MIM-D3 | Drug Info | [544321] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| Pathways | |||||
| KEGG Pathway | MAPK signaling pathway | ||||
| Endocytosis | |||||
| Apoptosis | |||||
| Neurotrophin signaling pathway | |||||
| Inflammatory mediator regulation of TRP channels | |||||
| Pathways in cancer | |||||
| Transcriptional misregulation in cancer | |||||
| Thyroid cancer | |||||
| Central carbon metabolism in cancer | |||||
| NetPath Pathway | IL2 Signaling Pathway | ||||
| Pathway Interaction Database | Neurotrophic factor-mediated Trk receptor signaling | ||||
| Reactome | Frs2-mediated activation | ||||
| ARMS-mediated activation | |||||
| NGF-independant TRKA activation | |||||
| PI3K/AKT activation | |||||
| WikiPathways | MAPK Signaling Pathway | ||||
| BDNF signaling pathway | |||||
| Integrated Pancreatic Cancer Pathway | |||||
| NGF signalling via TRKA from the plasma membrane | |||||
| References | |||||
| Ref 524232 | ClinicalTrials.gov (NCT01808157) A Study to Evaluate the Efficacy, Safety and Tolerability of CT327 in Atopic Dermatitis. U.S. National Institutes of Health. | ||||
| Ref 524465 | ClinicalTrials.gov (NCT01960010) A Safety and Efficacy Study of MIM-D3 Ophthalmic Solution for the Treatment of Dry Eye. U.S. National Institutes of Health. | ||||
| Ref 524734 | ClinicalTrials.gov (NCT02122913) Oral TRK Inhibitor LOXO-101 for Treatment of Advanced Adult Solid Tumors. U.S. National Institutes of Health. | ||||
| Ref 524973 | ClinicalTrials.gov (NCT02279433) A First-in-human Study to Evaluate the Safety, Tolerability and Pharmacokinetics of DS-6051b. U.S. National Institutes of Health. | ||||
| Ref 532994 | ALK inhibitors in non-small cell lung cancer: crizotinib and beyond. Clin Adv Hematol Oncol. 2014 Jul;12(7):429-39. | ||||
| Ref 548789 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028850) | ||||
| Ref 525414 | Topical TrkA Kinase Inhibitor CT327 is an Effective, Novel Therapy for the Treatment of Pruritus due to Psoriasis: Results from Experimental Studies, and Efficacy and Safety of CT327 in a Phase 2b Clinical Trial in Patients with Psoriasis. Acta Derm Venereol. 2015 May;95(5):542-8. | ||||
| Ref 526991 | Bioorg Med Chem Lett. 2004 Feb 23;14(4):953-7.Discovery and in vitro evaluation of potent TrkA kinase inhibitors: oxindole and aza-oxindoles. | ||||
| Ref 527569 | J Med Chem. 2005 Jun 2;48(11):3776-83.Synthesis, modeling, and in vitro activity of (3'S)-epi-K-252a analogues. Elucidating the stereochemical requirements of the 3'-sugar alcohol on trkA tyrosine kinase activity. | ||||
| Ref 529647 | J Med Chem. 2008 Sep 25;51(18):5680-9. Epub 2008 Aug 21.Mixed-lineage kinase 1 and mixed-lineage kinase 3 subtype-selective dihydronaphthyl[3,4-a]pyrrolo[3,4-c]carbazole-5-ones: optimization, mixed-lineage kinase 1 crystallography, and oral in vivo activity in 1-methyl-4-phenyltetrahydropyridine models. | ||||
| Ref 543043 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8290). | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
