Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T40474
|
||||
| Former ID |
TTDC00110
|
||||
| Target Name |
Hepatocyte growth factor receptor
|
||||
| Gene Name |
MET
|
||||
| Synonyms |
C-Met receptor tyrosine kinase; C-met; HGF receptor; HGF-SF receptor; Met proto-oncogene tyrosine kinase; MET
|
||||
| Target Type |
Successful
|
||||
| Disease | ALK-positive advanced or metastatic NSCLC [ICD9: 162; ICD10: C33, C34] | ||||
| Alzheimer disease [ICD9: 331; ICD10: G30] | |||||
| Advanced solid tumor [ICD9: 140-199; ICD10: C00-C75, C7A, C7B] | |||||
| Advanced cancers [ICD9: 140-229; ICD10: C00-C96] | |||||
| Chemotherapy-induced mucositis [ICD9: 528; ICD10: K12.3] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Fibrosis [ICD9: 709.2; ICD10: L90.5] | |||||
| Gastric cancer; Renal cell carcinoma; Squamous cell cancer of head and neck [ICD9: 140-229, 151, 189; ICD10: C16, C64] | |||||
| Hepatocellular carcinoma [ICD9: 155; ICD10: C22.0] | |||||
| Heart disease [ICD9: 390-429; ICD10: I00-I52] | |||||
| Head and neck cancer [ICD9: 140-149, 140-229; ICD10: C07-C14, C32-C33] | |||||
| Liver disease [ICD9: 570-574; ICD10: K70-K77] | |||||
| Metastatic HER2-negative gastric cancer; Non-small cell lung cancer [ICD9:140-229, 151; ICD10: C16, C33-C34] | |||||
| Medullary thyroid cancer [ICD9: 193; ICD10: C73] | |||||
| Metastatic castration-resistant prostate cancer; Ovarian cancer [ICD9: 140-229, 183, 185; ICD10: C56, C61] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Thyroid cancer; Renal cell carcinoma [ICD9: 140-229, 189, 193; ICD10: C64, C73] | |||||
| Function |
Acts as a receptor for Listeria internalin inlB, mediating entry of the pathogen into cells.
|
||||
| BioChemical Class |
Kinase
|
||||
| Target Validation |
T40474
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.10.1
|
||||
| Sequence |
MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEH
HIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMAL VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSAL GAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPE FRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECIL TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS AMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFL LDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGW CHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKK TRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVIT SISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF AVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSVPRMVINVH EAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDL LKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQ IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGS CRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF NEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW HPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVD TRPASFWETS |
||||
| Structure |
1FYR; 1R0P; 1R1W; 1SHY; 1SSL; 1UX3; 2G15; 2RFN; 2RFS; 2UZX; 2UZY; 2WD1; 2WGJ; 2WKM; 3A4P; 3BUX; 3C1X; 3CCN; 3CD8; 3CE3; 3CTH; 3CTJ; 3DKC; 3DKF; 3DKG; 3EFJ; 3EFK; 3F66; 3F82; 3I5N; 3L8V; 3LQ8; 3Q6U; 3Q6W; 3QTI; 3R7O; 3RHK; 3U6H; 3U6I; 3VW8; 3ZBX; 3ZC5; 3ZCL; 3ZXZ; 3ZZE; 4AOI; 4AP7; 4DEG; 4DEH; 4DEI; 4EEV; 4GG5; 4GG7; 4IWD; 4K3J; 4KNB; 4MXC; 4O3T; 4O3U
|
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Cabozantinib | Drug Info | Approved | Medullary thyroid cancer | [541185], [550636] |
| Crizotinib | Drug Info | Approved | ALK-positive advanced or metastatic NSCLC | [468091], [531783] | |
| Beperminogene perplasmid | Drug Info | Phase 3 | Heart disease | [524769] | |
| RG3638 | Drug Info | Phase 3 | Metastatic HER2-negative gastric cancer; Non-small cell lung cancer | [525252] | |
| Tivantinib | Drug Info | Phase 3 | Solid tumours | [532586], [542863] | |
| AMG 208 | Drug Info | Phase 2 | Solid tumours | [525156] | |
| AMG 337 | Drug Info | Phase 2 | Cancer | [524576] | |
| Cabozantinib | Drug Info | Phase 2 | Metastatic castration-resistant prostate cancer; Ovarian cancer | [541185], [550636] | |
| HM-5016504 | Drug Info | Phase 2 | Cancer | [524739] | |
| INCB28060 | Drug Info | Phase 2 | Hepatocellular carcinoma | [549049] | |
| LY-2875358 | Drug Info | Phase 2 | Cancer | [524369] | |
| LY2801653 | Drug Info | Phase 2 | Cancer | [523337] | |
| SAR-125844 | Drug Info | Phase 2 | Solid tumours | [525180] | |
| Volitinib | Drug Info | Phase 2 | Solid tumours | [524739] | |
| XL880 | Drug Info | Phase 2 | Gastric cancer; Renal cell carcinoma; Squamous cell cancer of head and neck | [541022], [550637] | |
| BMS-777607 | Drug Info | Phase 1/2 | Discovery agent | [522210], [542869] | |
| ChronSeal | Drug Info | Phase 1/2 | Fibrosis | [522498] | |
| MK-2461 | Drug Info | Phase 1/2 | Alzheimer disease | [530708] | |
| MSC2156119 | Drug Info | Phase 1/2 | Cancer | [524522] | |
| Cabozantinib | Drug Info | Phase 1b | Thyroid cancer; Renal cell carcinoma | [541185], [550636] | |
| ABT-700 | Drug Info | Phase 1 | Advanced solid tumor | [523689] | |
| Altiratinib | Drug Info | Phase 1 | Solid tumours | [549538] | |
| E-7050 | Drug Info | Phase 1 | Head and neck cancer | [525301], [542872] | |
| EMD-1204831 | Drug Info | Phase 1 | Solid tumours | [523018] | |
| EMD-1214063 | Drug Info | Phase 1 | Solid tumours | [522858], [543046] | |
| Hepapoietin | Drug Info | Phase 1 | Liver disease | [526279] | |
| JNJ-38877605 | Drug Info | Phase 1 | Solid tumours | [522280] | |
| LY3164530 | Drug Info | Phase 1 | Advanced cancers | [889401] | |
| Merestinib, LY2801653 | Drug Info | Phase 1 | Cancer | [551094] | |
| MGCD516 | Drug Info | Phase 1 | Solid tumours | [524880] | |
| MK-8033 | Drug Info | Phase 1 | Solid tumours | [522158] | |
| PF-4217903 | Drug Info | Phase 1 | Cancer | [522363] | |
| SGX523 | Drug Info | Phase 1 | Solid tumours | [522216], [541048] | |
| XL880 | Drug Info | Phase 1 | Solid tumours | [541022], [550637] | |
| Mteron-F1 | Drug Info | Preclinical | Chemotherapy-induced mucositis | [536838] | |
| Inhibitor | 1-(2-nitrophenethyl)-1H-pyrrolo[3,2-b]pyridine | Drug Info | [530081] | ||
| 1-(phenylsulfonyl)-1H-pyrrolo[3,2-b]pyridine | Drug Info | [530081] | |||
| 1-benzyl-1H-pyrrolo[3,2-b]pyridine | Drug Info | [530081] | |||
| 3-(phenylsulfonyl)-1H-pyrrolo[2,3-b]pyridine | Drug Info | [530081] | |||
| Altiratinib | Drug Info | [550598] | |||
| AM7 | Drug Info | [529195] | |||
| Anti-cMET mab | Drug Info | [543501] | |||
| APS-3010 | Drug Info | [543501] | |||
| BAY-85-3474 | Drug Info | [543501] | |||
| BMS-536924 | Drug Info | [527711] | |||
| BMS-777607 | Drug Info | [529996] | |||
| C-Met kinase inhibitors | Drug Info | [543501] | |||
| Cabozantinib | Drug Info | [550636] | |||
| ChronSeal | Drug Info | [551075] | |||
| CMET Avimer polypeptides | Drug Info | [543501] | |||
| compound 16 | Drug Info | [529760] | |||
| compound 1o | Drug Info | [532542] | |||
| compound 27 | Drug Info | [531279] | |||
| compound R-16 | Drug Info | [531645] | |||
| DP-3590 | Drug Info | [543501] | |||
| EMD-1204831 | Drug Info | [549717] | |||
| Hepapoietin | Drug Info | [550038] | |||
| HM-5016504 | Drug Info | [543501] | |||
| JNJ-38877605 | Drug Info | [533168] | |||
| MG-516 | Drug Info | [543501] | |||
| MGCD516 | Drug Info | [531337] | |||
| MK-2461 | Drug Info | [530708] | |||
| MK-8033 | Drug Info | [549718] | |||
| MSC2156119 | Drug Info | [533163] | |||
| PF-00614435 | Drug Info | [543501] | |||
| PF-4217903 | Drug Info | [531829] | |||
| PHA-665752 | Drug Info | [543501] | |||
| PRS-110 | Drug Info | [543501] | |||
| RP-1040 | Drug Info | [543501] | |||
| SAR-125844 | Drug Info | [533073] | |||
| SGX523 | Drug Info | [550543] | |||
| SU11274 | Drug Info | [526884] | |||
| Tivantinib | Drug Info | [542863] | |||
| TP-801 | Drug Info | [543501] | |||
| Modulator | ABT-700 | Drug Info | [549696] | ||
| AMG 208 | Drug Info | [533283] | |||
| AMG 337 | Drug Info | [549689] | |||
| Beperminogene perplasmid | Drug Info | [532942] | |||
| Crizotinib | Drug Info | [551871] | |||
| E-7050 | Drug Info | [530452] | |||
| EMD-1214063 | Drug Info | [532293] | |||
| GE-137 | Drug Info | [533287] | |||
| INCB28060 | Drug Info | [550454] | |||
| LY2801653 | Drug Info | [532170], [551095] | |||
| LY3164530 | Drug Info | [889442] | |||
| Merestinib, LY2801653 | Drug Info | [531996] | |||
| RG3638 | Drug Info | [543501] | |||
| Volitinib | Drug Info | [550990] | |||
| XL880 | Drug Info | [1572591] | |||
| Stimulator | Mteron-F1 | Drug Info | [536838] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Ras signaling pathway | ||||
| Rap1 signaling pathway | |||||
| Cytokine-cytokine receptor interaction | |||||
| Endocytosis | |||||
| PI3K-Akt signaling pathway | |||||
| Axon guidance | |||||
| Focal adhesion | |||||
| Adherens junction | |||||
| Bacterial invasion of epithelial cells | |||||
| Epithelial cell signaling in Helicobacter pylori infection | |||||
| Malaria | |||||
| Pathways in cancer | |||||
| Transcriptional misregulation in cancer | |||||
| Proteoglycans in cancer | |||||
| MicroRNAs in cancer | |||||
| Renal cell carcinoma | |||||
| Melanoma | |||||
| Central carbon metabolism in cancer | |||||
| Pathway Interaction Database | Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met) | ||||
| Arf6 signaling events | |||||
| Signaling events mediated by TCPTP | |||||
| Posttranslational regulation of adherens junction stability and dissassembly | |||||
| Direct p53 effectors | |||||
| Syndecan-1-mediated signaling events | |||||
| Stabilization and expansion of the E-cadherin adherens junction | |||||
| a6b1 and a6b4 Integrin signaling | |||||
| FGF signaling pathway | |||||
| Regulation of retinoblastoma protein | |||||
| Reactome | Sema4D mediated inhibition of cell attachment and migration | ||||
| WikiPathways | TGF beta Signaling Pathway | ||||
| Signaling of Hepatocyte Growth Factor Receptor | |||||
| Focal Adhesion | |||||
| Extracellular vesicle-mediated signaling in recipient cells | |||||
| Signaling Pathways in Glioblastoma | |||||
| miR-targeted genes in squamous cell - TarBase | |||||
| miR-targeted genes in muscle cell - TarBase | |||||
| miR-targeted genes in lymphocytes - TarBase | |||||
| miR-targeted genes in epithelium - TarBase | |||||
| Semaphorin interactions | |||||
| References | |||||
| Ref 468091 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4903). | ||||
| Ref 522158 | ClinicalTrials.gov (NCT00559182) A Study of MK-8033 in Patients With Advanced Solid Tumors (MK-8033-001). U.S. National Institutes of Health. | ||||
| Ref 522210 | ClinicalTrials.gov (NCT00605618) Multiple Ascending Dose Study of BMS-777607 in Subjects With Advanced or Metastatic Solid Tumors. U.S. National Institutes of Health. | ||||
| Ref 522216 | ClinicalTrials.gov (NCT00607399) Safety Study of SGX523, a Small Molecule Met Inhibitor, to Treat Solid Tumors. U.S. National Institutes of Health. | ||||
| Ref 522280 | ClinicalTrials.gov (NCT00651365) A Safety and Dose-finding Study of JNJ-38877605 in Patients With Advanced or Refractory Solid Tumors.. U.S. National Institutes of Health. | ||||
| Ref 522363 | ClinicalTrials.gov (NCT00706355) A Study of PF-04217903 in Patients With Advanced Cancer. U.S. National Institutes of Health. | ||||
| Ref 522498 | ClinicalTrials.gov (NCT00797706) Phase I/II Dose Ranging CHRONSEAL Study in Venous Leg Ulcers. U.S. National Institutes of Health. | ||||
| Ref 522858 | ClinicalTrials.gov (NCT01014936) First-in-Man, Dose-escalation Trial of C-met Kinase Inhibitor MSC2156119J in Subjects With Advanced Solid Tumors. U.S. National Institutes of Health. | ||||
| Ref 523018 | ClinicalTrials.gov (NCT01110083) First-in-Man, Dose-escalation Trial of c-Met Kinase Inhibitor EMD 1204831 in Subjects With Advanced Solid Tumors. U.S. National Institutes of Health. | ||||
| Ref 523337 | ClinicalTrials.gov (NCT01285037) A Study of LY2801653 in Advanced Cancer. U.S. National Institutes of Health. | ||||
| Ref 523689 | ClinicalTrials.gov (NCT01472016) Study of ABT-700 in Subjects With Advanced Solid Tumors. U.S. National Institutes of Health. | ||||
| Ref 524369 | ClinicalTrials.gov (NCT01900652) A Study of LY2875358 in Non Small Cell Lung Cancer (NSCLC) Participants. U.S. National Institutes of Health. | ||||
| Ref 524522 | ClinicalTrials.gov (NCT01982955) MSC2156119J With Gefitinib in Subjects With Advanced Non-small Cell Lung Cancer. U.S. National Institutes of Health. | ||||
| Ref 524576 | ClinicalTrials.gov (NCT02016534) Phase 2 Study of AMG 337 in MET Amplified Gastric/Esophageal Adenocarcinoma or Other Solid Tumors. U.S. National Institutes of Health. | ||||
| Ref 524739 | ClinicalTrials.gov (NCT02127710) A Phase II Trial to Evaluate the Efficacy of AZD6094 (HMPL-504) in Patients With Papillary Renal Cell Carcinoma (PRCC). U.S. National Institutes of Health. | ||||
| Ref 524769 | ClinicalTrials.gov (NCT02144610) Safety and Efficacy of Subjects With Critical Limb Ischemia. U.S. National Institutes of Health. | ||||
| Ref 524880 | ClinicalTrials.gov (NCT02219711) Phase 1/1b Study of MGCD516 in Patients With Advanced Cancer. U.S. National Institutes of Health. | ||||
| Ref 525156 | ClinicalTrials.gov (NCT02420587) AMG 208 Tumor Microenvironment in Metastatic Castration Resistant Prostate Cancer (mCRPC). U.S. National Institutes of Health. | ||||
| Ref 525180 | ClinicalTrials.gov (NCT02435121) A Study Assessing Efficacy and Safety of SAR125844 in NSCLC Patients With MET Amplification. U.S. National Institutes of Health. | ||||
| Ref 525252 | ClinicalTrials.gov (NCT02488330) An Extension Study of Onartuzumab in Patients With Solid Tumors on Study Treatment Previously Enrolled in a Company Sponsored Study. | ||||
| Ref 525301 | ClinicalTrials.gov (NCT02533102) Pharmacokinetics and Food Effect of Single Oral Dose of E7050 in Healthy Volunteers. | ||||
| Ref 526279 | Pharmacokinetics and biochemical effects of hepapoietin in patients with chronic liver disease. Aliment Pharmacol Ther. 2002 Feb;16(2):235-42. | ||||
| Ref 530708 | MK-2461, a novel multitargeted kinase inhibitor, preferentially inhibits the activated c-Met receptor. Cancer Res. 2010 Feb 15;70(4):1524-33. | ||||
| Ref 532586 | A phase II trial of a selective c-Met inhibitor tivantinib (ARQ 197) monotherapy as a second- or third-line therapy in the patients with metastatic gastric cancer. Invest New Drugs. 2014 Apr;32(2):355-61. | ||||
| Ref 536838 | Emerging drugs for chemotherapy-induced mucositis. Expert Opin Emerg Drugs. 2008 Sep;13(3):511-22. | ||||
| Ref 541022 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5679). | ||||
| Ref 541048 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5709). | ||||
| Ref 541185 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5887). | ||||
| Ref 542863 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7948). | ||||
| Ref 542869 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7953). | ||||
| Ref 542872 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7956). | ||||
| Ref 543046 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8293). | ||||
| Ref 549049 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031741) | ||||
| Ref 526884 | Potent and selective inhibitors of the Met [hepatocyte growth factor/scatter factor (HGF/SF) receptor] tyrosine kinase block HGF/SF-induced tumor cell growth and invasion. Mol Cancer Ther. 2003 Nov;2(11):1085-92. | ||||
| Ref 527711 | J Med Chem. 2005 Sep 8;48(18):5639-43.Discovery of a (1H-benzoimidazol-2-yl)-1H-pyridin-2-one (BMS-536924) inhibitor of insulin-like growth factor I receptor kinase with in vivo antitumor activity. | ||||
| Ref 529195 | c-Met inhibitors with novel binding mode show activity against several hereditary papillary renal cell carcinoma-related mutations. J Biol Chem. 2008 Feb 1;283(5):2675-83. Epub 2007 Nov 30. | ||||
| Ref 529760 | Pyrrolo-pyrimidones: a novel class of MK2 inhibitors with potent cellular activity. Bioorg Med Chem Lett. 2008 Dec 1;18(23):6142-6. | ||||
| Ref 529996 | J Med Chem. 2009 Mar 12;52(5):1251-4.Discovery of N-(4-(2-amino-3-chloropyridin-4-yloxy)-3-fluorophenyl)-4-ethoxy-1-(4-fluorophenyl)-2-oxo-1,2-dihydropyridine-3-carboxamide (BMS-777607), a selective and orally efficacious inhibitor of the Met kinase superfamily. | ||||
| Ref 530081 | Bioorg Med Chem Lett. 2009 May 15;19(10):2780-4. Epub 2009 Mar 27.Discovery of 4-azaindoles as novel inhibitors of c-Met kinase. | ||||
| Ref 530452 | E7050: a dual c-Met and VEGFR-2 tyrosine kinase inhibitor promotes tumor regression and prolongs survival in mouse xenograft models. Cancer Sci. 2010 Jan;101(1):210-5. | ||||
| Ref 530708 | MK-2461, a novel multitargeted kinase inhibitor, preferentially inhibits the activated c-Met receptor. Cancer Res. 2010 Feb 15;70(4):1524-33. | ||||
| Ref 531279 | Fused bicyclic derivatives of 2,4-diaminopyrimidine as c-Met inhibitors. Bioorg Med Chem Lett. 2011 Jan 1;21(1):164-7. | ||||
| Ref 531337 | Role and relevance of TrkB mutations and expression in non-small cell lung cancer. Clin Cancer Res. 2011 May 1;17(9):2638-45. | ||||
| Ref 531645 | Improvement in oral bioavailability of 2,4-diaminopyrimidine c-Met inhibitors by incorporation of a 3-amidobenzazepin-2-one group. Bioorg Med Chem. 2011 Nov 1;19(21):6274-84. | ||||
| Ref 531829 | Sensitivity of selected human tumor models to PF-04217903, a novel selective c-Met kinase inhibitor. Mol Cancer Ther. 2012 Apr;11(4):1036-47. | ||||
| Ref 531996 | The c-Met inhibitors: a new class of drugs in the battle against advanced nonsmall-cell lung cancer. Curr Pharm Des. 2012;18(37):6155-68. | ||||
| Ref 532170 | LY2801653 is an orally bioavailable multi-kinase inhibitor with potent activity against MET, MST1R, and other oncoproteins, and displays anti-tumor activities in mouse xenograft models. Invest New Drugs. 2013 Aug;31(4):833-44. | ||||
| Ref 532293 | EMD 1214063 and EMD 1204831 constitute a new class of potent and highly selective c-Met inhibitors. Clin Cancer Res. 2013 Jun 1;19(11):2941-51. | ||||
| Ref 532542 | Design and synthesis of novel 3-(benzo[d]oxazol-2-yl)-5-(1-(piperidin-4-yl)-1H-pyrazol-4-yl)pyridin-2-amine derivatives as selective G-protein-coupled receptor kinase-2 and -5 inhibitors. Bioorg Med Chem Lett. 2013 Dec 15;23(24):6711-6. | ||||
| Ref 532942 | Beperminogene perplasmid for the treatment of critical limb ischemia. Expert Rev Cardiovasc Ther. 2014 Oct;12(10):1145-56. | ||||
| Ref 532965 | LY2875358, a neutralizing and internalizing anti-MET bivalent antibody, inhibits HGF-dependent and HGF-independent MET activation and tumor growth. Clin Cancer Res. 2014 Dec 1;20(23):6059-70. | ||||
| Ref 533073 | The selective intravenous inhibitor of the MET tyrosine kinase SAR125844 inhibits tumor growth in MET-amplified cancer. Mol Cancer Ther. 2015 Feb;14(2):384-94. | ||||
| Ref 533163 | Identification and optimization of pyridazinones as potent and selective c-Met kinase inhibitors. Bioorg Med Chem Lett. 2015 Apr 1;25(7):1597-602. | ||||
| Ref 533168 | The c-Met Tyrosine Kinase Inhibitor JNJ-38877605 Causes Renal Toxicity through Species-Specific Insoluble Metabolite Formation. Clin Cancer Res. 2015 May 15;21(10):2297-304. | ||||
| Ref 533283 | A first-in-human study of AMG 208, an oral MET inhibitor, in adult patients with advanced solid tumors. Oncotarget. 2015 Jul 30;6(21):18693-706. | ||||
| Ref 533287 | Detection of colorectal polyps in humans using an intravenously administered fluorescent peptide targeted against c-Met. Nat Med. 2015 Aug;21(8):955-61. | ||||
| Ref 536838 | Emerging drugs for chemotherapy-induced mucositis. Expert Opin Emerg Drugs. 2008 Sep;13(3):511-22. | ||||
| Ref 542863 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7948). | ||||
| Ref 543501 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1815). | ||||
| Ref 549718 | A novel c-Met inhibitor, MK8033, synergizes with carboplatin plus paclitaxel to inhibit ovarian cancer cell growth. Oncol Rep. 2013 May;29(5):2011-8. | ||||
| Ref 550038 | Pharmacokinetics and biochemical effects of hepapoietin in patients with chronic liver disease. Alimentary Pharmacology & Therapeutics Volume 16, Issue 2, pages 235-242, February 2002. | ||||
| Ref 551871 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
| Ref 889442 | Bispecific antibodies rise again. Nat Rev Drug Discov. 2014 Nov;13(11):799-801. doi: 10.1038/nrd4478. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
