Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T73475
|
||||
| Former ID |
TTDR00029
|
||||
| Target Name |
Matrilysin
|
||||
| Gene Name |
MMP7
|
||||
| Synonyms |
MMP-7; Matrin; Matrix metalloproteinase-7; Pump-1 protease; Uterine metalloproteinase; MMP7
|
||||
| Target Type |
Successful
|
||||
| Disease | Brain cancer [ICD9: 191, 225.0; ICD10: C71, D33] | ||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Lung cancer; Prostate cancer [ICD9: 140-229, 162, 185; ICD10: C33-C34, C61] | |||||
| Non-small-cell lung cancer; Hormone-refractory prostate cancer; Kaposi's sarcoma [ICD9: 140-229, 162, 176, 185, 204.0; ICD10: C33, C33-C34, C34, C46, C61, C91.0] | |||||
| Pancreatic cancer; Lung cancer [ICD9: 140-229, 157, 162; ICD10: C25, C33-C34] | |||||
| Pancreatic cancer [ICD9: 140-199, 140-229, 157, 210-229; ICD10: C25] | |||||
| Function |
Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.
|
||||
| BioChemical Class |
Peptidase
|
||||
| Target Validation |
T73475
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.4.24.23
|
||||
| Sequence |
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD PQNFKLSQDDIKGIQKLYGKRSNSRKK |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Prinomastat | Drug Info | Approved | Lung cancer; Prostate cancer | [536056], [541642] |
| Marimastat | Drug Info | Phase 3 | Pancreatic cancer | [468274], [527314] | |
| BMS 275291 | Drug Info | Discontinued in Phase 3 | Non-small-cell lung cancer; Hormone-refractory prostate cancer; Kaposi's sarcoma | [536608] | |
| Marimastat | Drug Info | Discontinued in Phase 3 | Pancreatic cancer; Lung cancer | [468274], [536223] | |
| Prinomastat | Drug Info | Discontinued in Phase 3 | Brain cancer | [536056], [541642] | |
| BB-3644 | Drug Info | Terminated | Cancer | [535909] | |
| SC-44463 | Drug Info | Terminated | Discovery agent | [546364] | |
| Inhibitor | 3-Benzenesulfonyl-heptanoic acid hydroxyamide | Drug Info | [525813] | ||
| 3-Cyclohexanesulfonyl-heptanoic acid hydroxyamide | Drug Info | [525813] | |||
| BB-3644 | Drug Info | [528049], [535909] | |||
| BMS 275291 | Drug Info | [528049], [536019], [536073], [536608] | |||
| Folate gamma-hydroxamic acid | Drug Info | [528548] | |||
| Folate gamma-L-phenylalaninehydroxamic acid | Drug Info | [528548] | |||
| Folate gamma-L-proline-hydroxamic acid | Drug Info | [528548] | |||
| IK-682 | Drug Info | [526446] | |||
| Marimastat | Drug Info | [528049], [536340], [537040], [538064] | |||
| MMI270 | Drug Info | [528548] | |||
| N-hydroxy-2,3-bis(phenylsulfonamido)propanamide | Drug Info | [529443] | |||
| Prinomastat | Drug Info | [528049], [536127], [536723], [536808], [537136] | |||
| RS-39066 | Drug Info | [551301] | |||
| SC-44463 | Drug Info | [526680] | |||
| SL422 | Drug Info | [526113] | |||
| SR-973 | Drug Info | [528025] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Wnt signaling pathway | ||||
| NetPath Pathway | Wnt Signaling Pathway | ||||
| PANTHER Pathway | Alzheimer disease-presenilin pathway | ||||
| Wnt signaling pathway | |||||
| CCKR signaling map ST | |||||
| Pathway Interaction Database | Posttranslational regulation of adherens junction stability and dissassembly | ||||
| p75(NTR)-mediated signaling | |||||
| Syndecan-1-mediated signaling events | |||||
| Reactome | Collagen degradation | ||||
| Degradation of the extracellular matrix | |||||
| Activation of Matrix Metalloproteinases | |||||
| Assembly of collagen fibrils and other multimeric structures | |||||
| WikiPathways | Wnt Signaling Pathway and Pluripotency | ||||
| Activation of Matrix Metalloproteinases | |||||
| AGE/RAGE pathway | |||||
| Matrix Metalloproteinases | |||||
| References | |||||
| Ref 468274 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5220). | ||||
| Ref 527314 | Randomized phase III trial of marimastat versus placebo in patients with metastatic breast cancer who have responding or stable disease after first-line chemotherapy: Eastern Cooperative Oncology Group trial E2196. J Clin Oncol. 2004 Dec 1;22(23):4683-90. | ||||
| Ref 535909 | A phase I and pharmacological study of the matrix metalloproteinase inhibitor BB-3644 in patients with solid tumours. Br J Cancer. 2004 Feb 23;90(4):800-4. | ||||
| Ref 536223 | Emerging drugs for the treatment of chronic obstructive pulmonary disease. Expert Opin Emerg Drugs. 2006 May;11(2):275-91. | ||||
| Ref 536608 | Phase 1/2 trial of BMS-275291 in patients with human immunodeficiency virus-related Kaposi sarcoma: a multicenter trial of the AIDS Malignancy Consortium. Cancer. 2008 Mar 1;112(5):1083-8. | ||||
| Ref 525813 | J Med Chem. 2000 Jun 15;43(12):2324-31.Hydroxamic acid derivatives as potent peptide deformylase inhibitors and antibacterial agents. | ||||
| Ref 526113 | Design, synthesis, and structure-activity relationships of macrocyclic hydroxamic acids that inhibit tumor necrosis factor alpha release in vitro and in vivo. J Med Chem. 2001 Aug 2;44(16):2636-60. | ||||
| Ref 526446 | J Med Chem. 2002 Nov 7;45(23):4954-7.Discovery of gamma-lactam hydroxamic acids as selective inhibitors of tumor necrosis factor alpha converting enzyme: design, synthesis, and structure-activity relationships. | ||||
| Ref 526680 | J Med Chem. 2003 Jul 31;46(16):3514-25.A potent, selective inhibitor of matrix metalloproteinase-3 for the topical treatment of chronic dermal ulcers. | ||||
| Ref 528025 | Bioorg Med Chem Lett. 2006 May 1;16(9):2357-63. Epub 2006 Feb 10.Synthesis and evaluation of succinoyl-caprolactam gamma-secretase inhibitors. | ||||
| Ref 528049 | Tumour microenvironment - opinion: validating matrix metalloproteinases as drug targets and anti-targets for cancer therapy. Nat Rev Cancer. 2006 Mar;6(3):227-39. | ||||
| Ref 528548 | Bioorg Med Chem. 2007 Feb 1;15(3):1266-74. Epub 2006 Nov 14.Methotrexate gamma-hydroxamate derivatives as potential dual target antitumor drugs. | ||||
| Ref 529443 | Bioorg Med Chem Lett. 2008 Jun 1;18(11):3333-7. Epub 2008 Apr 16.Novel bis-(arylsulfonamide) hydroxamate-based selective MMP inhibitors. | ||||
| Ref 535909 | A phase I and pharmacological study of the matrix metalloproteinase inhibitor BB-3644 in patients with solid tumours. Br J Cancer. 2004 Feb 23;90(4):800-4. | ||||
| Ref 536019 | Randomized phase II feasibility study of combining the matrix metalloproteinase inhibitor BMS-275291 with paclitaxel plus carboplatin in advanced non-small cell lung cancer. Lung Cancer. 2004 Dec;46(3):361-8. | ||||
| Ref 536073 | Randomized phase III study of matrix metalloproteinase inhibitor BMS-275291 in combination with paclitaxel and carboplatin in advanced non-small-cell lung cancer: National Cancer Institute of Canada-Clinical Trials Group Study BR.18. J Clin Oncol. 2005 Apr 20;23(12):2831-9. | ||||
| Ref 536340 | Metalloelastase (MMP-12) induced inflammatory response in mice airways: effects of dexamethasone, rolipram and marimastat. Eur J Pharmacol. 2007 Mar 15;559(1):75-81. Epub 2006 Dec 12. | ||||
| Ref 536608 | Phase 1/2 trial of BMS-275291 in patients with human immunodeficiency virus-related Kaposi sarcoma: a multicenter trial of the AIDS Malignancy Consortium. Cancer. 2008 Mar 1;112(5):1083-8. | ||||
| Ref 536723 | Pharmacoproteomics of a metalloproteinase hydroxamate inhibitor in breast cancer cells: dynamics of membrane type 1 matrix metalloproteinase-mediated membrane protein shedding. Mol Cell Biol. 2008 Aug;28(15):4896-914. Epub 2008 May 27. | ||||
| Ref 536808 | Delayed administration of a matrix metalloproteinase inhibitor limits progressive brain injury after hypoxia-ischemia in the neonatal rat. J Neuroinflammation. 2008 Aug 11;5:34. | ||||
| Ref 537040 | Matrix metalloproteinase-2 involvement in breast cancer progression: a mini-review. Med Sci Monit. 2009 Feb;15(2):RA32-40. | ||||
| Ref 537136 | Inhibition of gelatinase activity reduces neural injury in an ex vivo model of hypoxia-ischemia. Neuroscience. 2009 Jun 2;160(4):755-66. Epub 2009 Mar 9. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
