Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T56510
|
||||
| Former ID |
TTDC00168
|
||||
| Target Name |
Antiapoptotic protein BCL-XL
|
||||
| Gene Name |
BCL2L1
|
||||
| Synonyms |
Bcl-XL; Bcl2L1; Bcl2like protein 1; Apoptosis regulator Bcl-X; BCL2L1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Advanced small cell lung cancer; Relapsed or refractory chronic lymphocytic leukemia; Lymphoid malignancies [ICD9: 140-229, 140-239, 162, 162.9, 202, 204.0, 204.1, 208.9; ICD10: C33-C34, C34.90, C81-C86, C91-C95, C91.0, C91.1] | ||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
Isoform Bcl-X(S) promotes apoptosis.
|
||||
| BioChemical Class |
Bcl-2 family
|
||||
| Target Validation |
T56510
|
||||
| UniProt ID | |||||
| Sequence |
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK |
||||
| Structure |
1BXL; 1G5J; 1LXL; 1MAZ; 1R2D; 1R2E; 1R2G; 1R2H; 1R2I; 1YSG; 1YSI; 1YSN; 2B48; 2LP8; 2LPC; 2M03; 2M04; 2ME8; 2ME9; 2MEJ; 2O1Y; 2O2M; 2O2N; 2P1L; 2PON; 2YJ1; 2YQ6; 2YQ7; 2YXJ; 3CVA; 3FDL; 3FDM; 3INQ; 3IO8; 3PL7; 3QKD; 3R85; 3SP7; 3SPF; 3WIZ; 3ZK6; 3ZLN; 3ZLO; 3ZLR; 4A1U; 4A1W; 4AQ3; 4BPK; 4C52; 4C5D; 4CIN; 4EHR; 4HNJ; 4IEH; 4TUH; 1BXL; 1G5J; 1LXL; 1MAZ; 1R2D; 1R2E;1R2G; 1R2H; 1R2I; 1YSG; 1YSI; 1YSN; 2B48; 2LP8; 2LPC; 2M03; 2M04; 2ME8; 2ME9; 2MEJ; 2O1Y; 2O2M; 2O2N; 2P1L; 2PON; 2YJ1; 2YQ6; 2YQ7; 2YXJ; 3CVA; 3FDL; 3FDM; 3INQ; 3IO8; 3PL7; 3QKD; 3R85; 3SP7; 3SPF; 3WIZ; 3ZK6; 3ZLN; 3ZLO; 3ZLR; 4A1U; 4A1W; 4AQ3; 4BPK; 4C52; 4C5D; 4CIN; 4EHR; 4HNJ; 4IEH; 4TUH
|
||||
| Drugs and Mode of Action | |||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Ras signaling pathway | ||||
| NF-kappa B signaling pathway | |||||
| PI3K-Akt signaling pathway | |||||
| Apoptosis | |||||
| Jak-STAT signaling pathway | |||||
| Amyotrophic lateral sclerosis (ALS) | |||||
| Toxoplasmosis | |||||
| HTLV-I infection | |||||
| Pathways in cancer | |||||
| Transcriptional misregulation in cancer | |||||
| Pancreatic cancer | |||||
| Chronic myeloid leukemia | |||||
| Small cell lung cancer | |||||
| NetPath Pathway | IL2 Signaling Pathway | ||||
| TGF_beta_Receptor Signaling Pathway | |||||
| Notch Signaling Pathway | |||||
| PANTHER Pathway | Apoptosis signaling pathway | ||||
| CCKR signaling map ST | |||||
| Pathway Interaction Database | IL2 signaling events mediated by PI3K | ||||
| IL3-mediated signaling events | |||||
| Caspase Cascade in Apoptosis | |||||
| EPO signaling pathway | |||||
| IL2 signaling events mediated by STAT5 | |||||
| Reactome | BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members | ||||
| The NLRP1 inflammasome | |||||
| WikiPathways | IL-6 signaling pathway | ||||
| IL-3 Signaling Pathway | |||||
| Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways | |||||
| Apoptosis | |||||
| Amyotrophic lateral sclerosis (ALS) | |||||
| TNF alpha Signaling Pathway | |||||
| IL-7 Signaling Pathway | |||||
| Leptin signaling pathway | |||||
| Intrinsic Pathway for Apoptosis | |||||
| Apoptosis Modulation and Signaling | |||||
| References | |||||
| Ref 531104 | Phase II study of obatoclax mesylate (GX15-070), a small-molecule BCL-2 family antagonist, for patients with myelofibrosis. Clin Lymphoma Myeloma Leuk. 2010 Aug;10(4):285-9. | ||||
| Ref 531104 | Phase II study of obatoclax mesylate (GX15-070), a small-molecule BCL-2 family antagonist, for patients with myelofibrosis. Clin Lymphoma Myeloma Leuk. 2010 Aug;10(4):285-9. | ||||
| Ref 536702 | ABT-263: a potent and orally bioavailable Bcl-2 family inhibitor. Cancer Res. 2008 May 1;68(9):3421-8. | ||||
| Ref 536883 | ABT-263 and rapamycin act cooperatively to kill lymphoma cells in vitro and in vivo. Mol Cancer Ther. 2008 Oct;7(10):3265-74. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
