Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T51191
|
||||
| Former ID |
TTDR01156
|
||||
| Target Name |
Histone deacetylase 2
|
||||
| Gene Name |
HDAC2
|
||||
| Synonyms |
HDAC2
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
| Dermatitis [ICD9: 692.9; ICD10: L20-L30] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Forms transcriptional repressor complexes byassociating with MAD, SIN3, YY1 and N-COR. Interacts in the late S-phase of DNA-replication with DNMT1 in the other transcriptional repressor complex composed of DNMT1, DMAP1, PCNA, CAF1. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. May be involved in the transcriptional repression of circadian target genes, such as PER1, mediated by CRY1 through histone deacetylation. Involved in MTA1-mediated transcriptional corepression of TFF1 and CDKN1A.
|
||||
| BioChemical Class |
Carbon-nitrogen hydrolase
|
||||
| Target Validation |
T51191
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.5.1.98
|
||||
| Sequence |
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGT KSEQLSNP |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | (E)-8-Biphenyl-4-yl-1-oxazol-2-yl-oct-7-en-1-one | Drug Info | [526871] | ||
| 1,1,1-Trifluoro-8-(4-phenoxy-phenoxy)-octan-2-one | Drug Info | [526450] | |||
| 1,1,1-Trifluoro-8-phenoxy-octan-2-one | Drug Info | [526450] | |||
| 2-(allyloxy)-N8-hydroxy-N1-phenyloctanediamide | Drug Info | [529062] | |||
| 2-(benzyloxy)-N7-hydroxy-N1-phenylheptanediamide | Drug Info | [529062] | |||
| 2-(methylsulfonylthio)ethyl 2-propylpentanoate | Drug Info | [529333] | |||
| 4-Benzoylamino-N-hydroxy-benzamide | Drug Info | [527691] | |||
| 4-Butyrylamino-N-hydroxy-benzamide | Drug Info | [526922] | |||
| 4-Chloro-N-(5-hydroxycarbamoyl-pentyl)-benzamide | Drug Info | [526878] | |||
| 4-Dimethylamino-N-(6-mercapto-hexyl)-benzamide | Drug Info | [527439] | |||
| 4-Hydroxy-N-(5-hydroxycarbamoyl-pentyl)-benzamide | Drug Info | [526266] | |||
| 4-Phenylbutyrohydroxamic acid | Drug Info | [530700] | |||
| 5-(4-Chloro-phenyl)-pentanoic acid hydroxyamide | Drug Info | [527056] | |||
| 5-(4-hydroxyphenyl)-3H-1,2-dithiole-3-thione | Drug Info | [529333] | |||
| 5-(Biphenyl-4-yl)-pentanoic acid N-hydroxyamide | Drug Info | [529865] | |||
| 5-Mercapto-pentanoic acid phenylamide | Drug Info | [527439] | |||
| 6-(2-Bromo-acetylamino)-hexanoic acid phenylamide | Drug Info | [527439] | |||
| 6-benzenesulfinylhexanoic acid hydroxamide | Drug Info | [527980] | |||
| 6-benzenesulfonylhexanoic acid hydroxamide | Drug Info | [527980] | |||
| 6-Mercapto-hexanoic acid phenylamide | Drug Info | [527439] | |||
| 6-Phenoxy-hexane-1-thiol | Drug Info | [527439] | |||
| 6-phenylsulfanylhexanoic acid hydroxamide | Drug Info | [527980] | |||
| 7-(Biphenyl-3-yloxy)-1-oxazol-2-yl-heptan-1-one | Drug Info | [526871] | |||
| 7-(Biphenyl-4-yloxy)-1,1,1-trifluoro-heptan-2-one | Drug Info | [526450] | |||
| 7-(Biphenyl-4-yloxy)-1-oxazol-2-yl-heptan-1-one | Drug Info | [526871] | |||
| 7-(Biphenyl-4-yloxy)-heptanoic acid hydroxyamide | Drug Info | [526708] | |||
| 7-(Naphthalen-2-yloxy)-1-oxazol-2-yl-heptan-1-one | Drug Info | [526871] | |||
| 7-Biphenyl-4-yl-heptanoic acid hydroxyamide | Drug Info | [526847] | |||
| 7-Mercapto-heptanoic acid benzothiazol-2-ylamide | Drug Info | [527439] | |||
| 7-Mercapto-heptanoic acid biphenyl-3-ylamide | Drug Info | [527439] | |||
| 7-Mercapto-heptanoic acid biphenyl-4-ylamide | Drug Info | [527439] | |||
| 7-Mercapto-heptanoic acid phenylamide | Drug Info | [527439] | |||
| 7-Mercapto-heptanoic acid pyridin-3-ylamide | Drug Info | [527439] | |||
| 7-Mercapto-heptanoic acid quinolin-3-ylamide | Drug Info | [527439] | |||
| 7-Phenoxy-heptanoic acid hydroxyamide | Drug Info | [526847] | |||
| 8-(Biphenyl-3-yloxy)-1,1,1-trifluoro-octan-2-one | Drug Info | [526450] | |||
| 8-(Biphenyl-4-yloxy)-1,1,1-trifluoro-octan-2-one | Drug Info | [526450] | |||
| 8-(Biphenyl-4-yloxy)-2-oxo-octanoic acid | Drug Info | [526708] | |||
| 8-Mercapto-octanoic acid phenylamide | Drug Info | [527439] | |||
| 8-Oxo-8-phenyl-octanoic acid | Drug Info | [526266] | |||
| 8-Oxo-8-phenyl-octanoic acid hydroxyamide | Drug Info | [526878] | |||
| 8-Phenyl-octanoic acid hydroxyamide | Drug Info | [526847] | |||
| 9,9,9-Trifluoro-8-oxo-nonanoic acid phenylamide | Drug Info | [526450] | |||
| 9-(Biphenyl-4-yloxy)-1,1,1-trifluoro-nonan-2-one | Drug Info | [526450] | |||
| CHR-3996 | Drug Info | [531893] | |||
| Cyclostellettamine derivative | Drug Info | [527058] | |||
| KAR-1880 | Drug Info | [543661] | |||
| N-(2-amino-5-(benzofuran-2-yl)phenyl)benzamide | Drug Info | [530853] | |||
| N-(2-amino-5-(furan-2-yl)phenyl)benzamide | Drug Info | [530853] | |||
| N-(2-amino-5-(furan-3-yl)phenyl)benzamide | Drug Info | [530853] | |||
| N-(2-amino-5-(pyridin-4-yl)phenyl)benzamide | Drug Info | [530853] | |||
| N-(2-amino-5-(thiazol-2-yl)phenyl)benzamide | Drug Info | [530853] | |||
| N-(2-amino-5-(thiophen-2-yl)phenyl)nicotinamide | Drug Info | [529767] | |||
| N-(2-aminophenyl)-4-methoxybenzamide | Drug Info | [529104] | |||
| N-(2-aminophenyl)benzamide | Drug Info | [530853] | |||
| N-(2-aminophenyl)nicotinamide | Drug Info | [529767] | |||
| N-(2-aminophenyl)quinoxaline-6-carboxamide | Drug Info | [529104] | |||
| N-(2-Mercapto-ethyl)-N'-phenyl-oxalamide | Drug Info | [527500] | |||
| N-(2-Mercapto-ethyl)-N'-phenyl-succinamide | Drug Info | [527500] | |||
| N-(3'-acetyl-4-aminobiphenyl-3-yl)benzamide | Drug Info | [530853] | |||
| N-(4'-acetyl-4-aminobiphenyl-3-yl)benzamide | Drug Info | [530853] | |||
| N-(4-amino-3'-methoxybiphenyl-3-yl)benzamide | Drug Info | [530853] | |||
| N-(4-amino-3'-methylbiphenyl-3-yl)benzamide | Drug Info | [530853] | |||
| N-(4-amino-4'-bromobiphenyl-3-yl)benzamide | Drug Info | [530853] | |||
| N-(4-amino-4'-fluorobiphenyl-3-yl)benzamide | Drug Info | [530853] | |||
| N-(4-amino-4'-methoxybiphenyl-3-yl)benzamide | Drug Info | [530853] | |||
| N-(4-amino-4'-vinylbiphenyl-3-yl)benzamide | Drug Info | [530853] | |||
| N-(4-aminobiphenyl-3-yl)benzamide | Drug Info | [530853] | |||
| N-(4-aminobiphenyl-3-yl)nicotinamide | Drug Info | [529767] | |||
| N-(4-hydroxybiphenyl-3-yl)benzamide | Drug Info | [529767] | |||
| N-(5-Hydroxycarbamoyl-pentyl)-4-nitro-benzamide | Drug Info | [526878] | |||
| N-(6-Hydroxycarbamoyl-hexyl)-benzamide | Drug Info | [526266] | |||
| N-(6-Mercapto-hexyl)-benzamide | Drug Info | [527439] | |||
| N-Hydroxy-4-((R)-2-phenyl-butyrylamino)-benzamide | Drug Info | [527691] | |||
| N-Hydroxy-4-((S)-2-phenyl-butyrylamino)-benzamide | Drug Info | [527691] | |||
| N-Hydroxy-4-(2-phenyl-butyrylamino)-benzamide | Drug Info | [527691] | |||
| N-Hydroxy-4-(3-phenyl-propionylamino)-benzamide | Drug Info | [530261] | |||
| N-Hydroxy-4-(4-phenyl-butyrylamino)-benzamide | Drug Info | [527691] | |||
| N-Hydroxy-4-(5-phenyl-pentanoylamino)-benzamide | Drug Info | [527691] | |||
| N-Hydroxy-4-(pentanoylamino-methyl)-benzamide | Drug Info | [526922] | |||
| N-Hydroxy-4-(phenylacetylamino-methyl)-benzamide | Drug Info | [526922] | |||
| N-Hydroxy-4-phenylacetylamino-benzamide | Drug Info | [527691] | |||
| N-Hydroxy-E-3-(4'-chlorobiphenyl-4-yl)-acrylamide | Drug Info | [529865] | |||
| N-Hydroxy-E-3-(4'-cyanobiphenyl-4-yl)-acrylamide | Drug Info | [529865] | |||
| N-Hydroxy-E-3-(biphenyl-4-yl)-acrylamide | Drug Info | [529865] | |||
| N7-hydroxy-2-methoxy-N1-phenylheptanediamide | Drug Info | [529062] | |||
| N7-hydroxy-N1-phenyl-2-propoxyheptanediamide | Drug Info | [529062] | |||
| N8,2-dihydroxy-N1-phenyloctanediamide | Drug Info | [529062] | |||
| N8-hydroxy-2-methoxy-N1-phenyloctanediamide | Drug Info | [529062] | |||
| Octanedioic acid bis-hydroxyamide | Drug Info | [526376] | |||
| Octanedioic acid hydroxyamide pyridin-2-ylamide | Drug Info | [526266] | |||
| Octanedioic acid hydroxyamide pyridin-4-ylamide | Drug Info | [526266] | |||
| PSAMMAPLIN A | Drug Info | [526878] | |||
| santacruzamate A | Drug Info | [532523] | |||
| ST-2986 | Drug Info | [530016] | |||
| ST-2987 | Drug Info | [530016] | |||
| Thioacetic acid S-(6-phenylcarbamoyl-hexyl) ester | Drug Info | [527439] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cell cycle | ||||
| Notch signaling pathway | |||||
| Thyroid hormone signaling pathway | |||||
| Huntington' | |||||
| s disease | |||||
| Alcoholism | |||||
| Epstein-Barr virus infection | |||||
| Pathways in cancer | |||||
| Transcriptional misregulation in cancer | |||||
| Viral carcinogenesis | |||||
| Chronic myeloid leukemia | |||||
| NetPath Pathway | TCR Signaling Pathway | ||||
| PANTHER Pathway | Wnt signaling pathway | ||||
| Pathway Interaction Database | Regulation of nuclear SMAD2/3 signaling | ||||
| Signaling events mediated by HDAC Class I | |||||
| Regulation of Telomerase | |||||
| Glucocorticoid receptor regulatory network | |||||
| Direct p53 effectors | |||||
| Hedgehog signaling events mediated by Gli proteins | |||||
| Regulation of nuclear beta catenin signaling and target gene transcription | |||||
| Reactome | p75NTR negatively regulates cell cycle via SC1 | ||||
| NOTCH1 Intracellular Domain Regulates Transcription | |||||
| Constitutive Signaling by NOTCH1 PEST Domain Mutants | |||||
| Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants | |||||
| HDACs deacetylate histones | |||||
| NoRC negatively regulates rRNA expression | |||||
| RNA Polymerase I Transcription Initiation | |||||
| Factors involved in megakaryocyte development and platelet production | |||||
| WikiPathways | Notch Signaling Pathway | ||||
| Notch Signaling Pathway | |||||
| Neural Crest Differentiation | |||||
| Signalling by NGF | |||||
| RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription | |||||
| Factors involved in megakaryocyte development and platelet production | |||||
| Cell Cycle | |||||
| References | |||||
| Ref 526266 | J Med Chem. 2002 Feb 14;45(4):753-7.Inhibitors of human histone deacetylase: synthesis and enzyme and cellular activity of straight chain hydroxamates. | ||||
| Ref 526376 | J Med Chem. 2002 Jul 18;45(15):3296-309.Structure-activity relationships on phenylalanine-containing inhibitors of histone deacetylase: in vitro enzyme inhibition, induction of differentiation, and inhibition of proliferation in Friend leukemic cells. | ||||
| Ref 526450 | Bioorg Med Chem Lett. 2002 Dec 2;12(23):3443-7.Trifluoromethyl ketones as inhibitors of histone deacetylase. | ||||
| Ref 526708 | Bioorg Med Chem Lett. 2003 Oct 6;13(19):3331-5.Alpha-keto amides as inhibitors of histone deacetylase. | ||||
| Ref 526847 | Bioorg Med Chem Lett. 2003 Nov 3;13(21):3817-20.A novel series of histone deacetylase inhibitors incorporating hetero aromatic ring systems as connection units. | ||||
| Ref 526871 | Bioorg Med Chem Lett. 2003 Nov 17;13(22):3909-13.Heterocyclic ketones as inhibitors of histone deacetylase. | ||||
| Ref 526922 | J Med Chem. 2004 Jan 15;47(2):467-74.Zn2+-chelating motif-tethered short-chain fatty acids as a novel class of histone deacetylase inhibitors. | ||||
| Ref 527056 | Bioorg Med Chem Lett. 2004 May 17;14(10):2477-81.Stereodefined and polyunsaturated inhibitors of histone deacetylase based on (2E,4E)-5-arylpenta-2,4-dienoic acid hydroxyamides. | ||||
| Ref 527058 | Bioorg Med Chem Lett. 2004 May 17;14(10):2617-20.Three new cyclostellettamines, which inhibit histone deacetylase, from a marine sponge of the genus Xestospongia. | ||||
| Ref 527439 | J Med Chem. 2005 Feb 24;48(4):1019-32.Novel inhibitors of human histone deacetylases: design, synthesis, enzyme inhibition, and cancer cell growth inhibition of SAHA-based non-hydroxamates. | ||||
| Ref 527500 | Bioorg Med Chem Lett. 2005 Apr 15;15(8):1969-72.Mercaptoamide-based non-hydroxamic acid type histone deacetylase inhibitors. | ||||
| Ref 527691 | J Med Chem. 2005 Aug 25;48(17):5530-5.Structure-based optimization of phenylbutyrate-derived histone deacetylase inhibitors. | ||||
| Ref 527980 | J Med Chem. 2006 Jan 26;49(2):800-5.Aromatic sulfide inhibitors of histone deacetylase based on arylsulfinyl-2,4-hexadienoic acid hydroxyamides. | ||||
| Ref 529062 | Bioorg Med Chem Lett. 2007 Nov 15;17(22):6261-5. Epub 2007 Sep 8.Omega-alkoxy analogues of SAHA (vorinostat) as inhibitors of HDAC: a study of chain-length and stereochemical dependence. | ||||
| Ref 529104 | J Med Chem. 2007 Nov 15;50(23):5543-6. Epub 2007 Oct 17.Novel aminophenyl benzamide-type histone deacetylase inhibitors with enhanced potency and selectivity. | ||||
| Ref 529333 | Bioorg Med Chem Lett. 2008 Mar 15;18(6):1893-7. Epub 2008 Feb 8.New sulfurated derivatives of valproic acid with enhanced histone deacetylase inhibitory activity. | ||||
| Ref 529767 | Bioorg Med Chem Lett. 2008 Dec 1;18(23):6104-9. Epub 2008 Oct 14.SAR profiles of spirocyclic nicotinamide derived selective HDAC1/HDAC2 inhibitors (SHI-1:2). | ||||
| Ref 529865 | Eur J Med Chem. 2009 May;44(5):1900-12. Epub 2008 Nov 19.Design, synthesis, and evaluation of biphenyl-4-yl-acrylohydroxamic acid derivatives as histone deacetylase (HDAC) inhibitors. | ||||
| Ref 530016 | Bioorg Med Chem Lett. 2009 Apr 15;19(8):2346-9. Epub 2009 Feb 12.N-Hydroxy-(4-oxime)-cinnamide: a versatile scaffold for the synthesis of novel histone deacetylase [correction of deacetilase] (HDAC)inhibitors. | ||||
| Ref 530261 | Eur J Med Chem. 2009 Nov;44(11):4470-6. Epub 2009 Jun 17.Design, synthesis and preliminary biological evaluation of N-hydroxy-4-(3-phenylpropanamido)benzamide (HPPB) derivatives as novel histone deacetylase inhibitors. | ||||
| Ref 530700 | Nat Chem Biol. 2010 Mar;6(3):238-243. Epub 2010 Feb 7.Chemical phylogenetics of histone deacetylases. | ||||
| Ref 530853 | Bioorg Med Chem Lett. 2010 May 15;20(10):3142-5. Epub 2010 Mar 30.Exploration of the HDAC2 foot pocket: Synthesis and SAR of substituted N-(2-aminophenyl)benzamides. | ||||
| Ref 531893 | A phase I pharmacokinetic and pharmacodynamic study of CHR-3996, an oral class I selective histone deacetylase inhibitor in refractory solid tumors. Clin Cancer Res. 2012 May 1;18(9):2687-94. | ||||
| Ref 532523 | Santacruzamate A, a potent and selective histone deacetylase inhibitor from the Panamanian marine cyanobacterium cf. Symploca sp. J Nat Prod. 2013 Nov 22;76(11):2026-33. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
