Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T28887
|
||||
| Former ID |
TTDR01337
|
||||
| Target Name |
Histone Deacetylase 8
|
||||
| Gene Name |
HDAC8
|
||||
| Synonyms |
Histone deacetylase-8; HD8; HDAC8
|
||||
| Target Type |
Research
|
||||
| Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
| Function |
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Also involved in the deacetylation of cohesin complex protein SMC3 regulating release of cohesin complexes from chromatin. May play a role in smooth muscle cell contractility. {ECO:0000269|PubMed:10748112, ECO:0000269|PubMed:10922473, ECO:0000269|PubMed:10926844, ECO:0000269|PubMed:14701748, ECO:0000269|PubMed:22885700}.
|
||||
| BioChemical Class |
Carbon-nitrogen hydrolase
|
||||
| Target Validation |
T28887
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.5.1.98
|
||||
| Sequence |
MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPK
VASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATI TAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLH HGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKY YQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLI LGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPH RIQQILNYIKGNLKHVV |
||||
| Structure |
1T64; 1T67; 1T69; 1VKG; 1W22; 2V5W; 2V5X; 3EW8; 3EWF; 3EZP; 3EZT; 3F06; 3F07; 3F0R; 3MZ3; 3MZ4; 3MZ6; 3MZ7; 3RQD; 3SFF; 3SFH; 4QA0; 4QA1; 4QA2; 4QA3; 4QA4; 4QA5; 4QA6; 4QA7
|
||||
| Inhibitor | (E)-8-Biphenyl-4-yl-1-oxazol-2-yl-oct-7-en-1-one | Drug Info | [526871] | ||
| 2-(methylsulfonylthio)ethyl 2-propylpentanoate | Drug Info | [529333] | |||
| 4-Benzoylamino-N-hydroxy-benzamide | Drug Info | [527691] | |||
| 4-Butyrylamino-N-hydroxy-benzamide | Drug Info | [526922] | |||
| 4-Chloro-N-(5-hydroxycarbamoyl-pentyl)-benzamide | Drug Info | [526266] | |||
| 4-Dimethylamino-N-(6-mercapto-hexyl)-benzamide | Drug Info | [527439] | |||
| 4-Hydroxy-N-(5-hydroxycarbamoyl-pentyl)-benzamide | Drug Info | [526266] | |||
| 4-Phenylbutyrohydroxamic acid | Drug Info | [530700] | |||
| 5-(4-Chloro-phenyl)-pentanoic acid hydroxyamide | Drug Info | [527056] | |||
| 5-(4-hydroxyphenyl)-3H-1,2-dithiole-3-thione | Drug Info | [529333] | |||
| 5-Mercapto-pentanoic acid phenylamide | Drug Info | [527439] | |||
| 6-(2-Bromo-acetylamino)-hexanoic acid phenylamide | Drug Info | [527439] | |||
| 6-(2-mercaptoacetamido)-N-phenylhexanamide | Drug Info | [529285] | |||
| 6-benzenesulfinylhexanoic acid hydroxamide | Drug Info | [527980] | |||
| 6-benzenesulfonylhexanoic acid hydroxamide | Drug Info | [527980] | |||
| 6-Mercapto-hexanoic acid phenylamide | Drug Info | [527439] | |||
| 6-Phenoxy-hexane-1-thiol | Drug Info | [527439] | |||
| 6-phenylsulfanylhexanoic acid hydroxamide | Drug Info | [527980] | |||
| 7-(Biphenyl-3-yloxy)-1-oxazol-2-yl-heptan-1-one | Drug Info | [526871] | |||
| 7-(Biphenyl-4-yloxy)-1,1,1-trifluoro-heptan-2-one | Drug Info | [526878] | |||
| 7-(Biphenyl-4-yloxy)-1-oxazol-2-yl-heptan-1-one | Drug Info | [526871] | |||
| 7-(Naphthalen-2-yloxy)-1-oxazol-2-yl-heptan-1-one | Drug Info | [526871] | |||
| 7-Mercapto-heptanoic acid benzothiazol-2-ylamide | Drug Info | [527439] | |||
| 7-Mercapto-heptanoic acid biphenyl-3-ylamide | Drug Info | [527439] | |||
| 7-Mercapto-heptanoic acid biphenyl-4-ylamide | Drug Info | [527439] | |||
| 7-Mercapto-heptanoic acid phenylamide | Drug Info | [527439] | |||
| 7-Mercapto-heptanoic acid pyridin-3-ylamide | Drug Info | [527439] | |||
| 7-Mercapto-heptanoic acid quinolin-3-ylamide | Drug Info | [527439] | |||
| 8-(Biphenyl-4-yloxy)-1,1,1-trifluoro-octan-2-one | Drug Info | [526871] | |||
| 8-Mercapto-octanoic acid phenylamide | Drug Info | [527439] | |||
| 8-Oxo-8-phenyl-octanoic acid | Drug Info | [526266] | |||
| 9,9,9-Trifluoro-8-oxo-nonanoic acid phenylamide | Drug Info | [526878] | |||
| 9-(Biphenyl-4-yloxy)-1,1,1-trifluoro-nonan-2-one | Drug Info | [526878] | |||
| 9-mercapto-8-oxo-N-phenylnonanamide | Drug Info | [529285] | |||
| Azithromycin-N-benzyltriazolylhexahydroxamic Acid | Drug Info | [529875] | |||
| Azithromycin-N-benzyltriazolylnonahydroxamic Acid | Drug Info | [529875] | |||
| Azithromycin-N-benzyltriazolyloctahydroxamic Acid | Drug Info | [529875] | |||
| Azithromycinarylalkylhydroxamic Acid | Drug Info | [529875] | |||
| Cyclostellettamine derivative | Drug Info | [527058] | |||
| Desclasinose Azithromycinarylalkyl Hydroxamate | Drug Info | [529875] | |||
| droxinostat | Drug Info | [530619] | |||
| N-(2-Mercapto-ethyl)-N'-phenyl-oxalamide | Drug Info | [527500] | |||
| N-(2-Mercapto-ethyl)-N'-phenyl-succinamide | Drug Info | [527500] | |||
| N-(5-Hydroxycarbamoyl-pentyl)-4-nitro-benzamide | Drug Info | [526266] | |||
| N-(6-Hydroxycarbamoyl-hexyl)-benzamide | Drug Info | [526266] | |||
| N-(6-Mercapto-hexyl)-benzamide | Drug Info | [527439] | |||
| N-hydroxy-1-naphthamide | Drug Info | [528719] | |||
| N-hydroxy-3-(naphthalen-1-yl)acrylamide | Drug Info | [528719] | |||
| N-hydroxy-3-phenoxybenzamide | Drug Info | [528719] | |||
| N-Hydroxy-4-((R)-2-phenyl-butyrylamino)-benzamide | Drug Info | [527691] | |||
| N-Hydroxy-4-((S)-2-phenyl-butyrylamino)-benzamide | Drug Info | [527691] | |||
| N-Hydroxy-4-(2-phenyl-butyrylamino)-benzamide | Drug Info | [527691] | |||
| N-Hydroxy-4-(3-phenyl-propionylamino)-benzamide | Drug Info | [527691] | |||
| N-Hydroxy-4-(4-phenyl-butyrylamino)-benzamide | Drug Info | [527691] | |||
| N-Hydroxy-4-(5-phenyl-pentanoylamino)-benzamide | Drug Info | [527691] | |||
| N-hydroxy-4-(naphthalen-1-yl)benzamide | Drug Info | [528719] | |||
| N-Hydroxy-4-(pentanoylamino-methyl)-benzamide | Drug Info | [526922] | |||
| N-Hydroxy-4-(phenylacetylamino-methyl)-benzamide | Drug Info | [526922] | |||
| N-Hydroxy-4-phenylacetylamino-benzamide | Drug Info | [527691] | |||
| NILTUBACIN | Drug Info | [530700] | |||
| NMB-T-BMX-OS01 | Drug Info | [543663] | |||
| Octanedioic acid bis-hydroxyamide | Drug Info | [530700] | |||
| Octanedioic acid hydroxyamide pyridin-2-ylamide | Drug Info | [526266] | |||
| Octanedioic acid hydroxyamide pyridin-4-ylamide | Drug Info | [526266] | |||
| PCI-34051 | Drug Info | [543663] | |||
| PSAMMAPLIN A | Drug Info | [526878] | |||
| S-2,9-dioxo-9-(phenylamino)nonyl ethanethioate | Drug Info | [529285] | |||
| ST-2986 | Drug Info | [530016] | |||
| ST-2987 | Drug Info | [530016] | |||
| ST-3050 | Drug Info | [530016] | |||
| Thioacetic acid S-(6-phenylcarbamoyl-hexyl) ester | Drug Info | [527439] | |||
| Pathways | |||||
| KEGG Pathway | Alcoholism | ||||
| Viral carcinogenesis | |||||
| PANTHER Pathway | Wnt signaling pathway | ||||
| Pathway Interaction Database | Signaling events mediated by HDAC Class I | ||||
| Reactome | NOTCH1 Intracellular Domain Regulates Transcription | ||||
| Constitutive Signaling by NOTCH1 PEST Domain Mutants | |||||
| Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants | |||||
| HDACs deacetylate histones | |||||
| WikiPathways | Integrated Pancreatic Cancer Pathway | ||||
| Neural Crest Differentiation | |||||
| Cell Cycle | |||||
| References | |||||
| Ref 526266 | J Med Chem. 2002 Feb 14;45(4):753-7.Inhibitors of human histone deacetylase: synthesis and enzyme and cellular activity of straight chain hydroxamates. | ||||
| Ref 526871 | Bioorg Med Chem Lett. 2003 Nov 17;13(22):3909-13.Heterocyclic ketones as inhibitors of histone deacetylase. | ||||
| Ref 526922 | J Med Chem. 2004 Jan 15;47(2):467-74.Zn2+-chelating motif-tethered short-chain fatty acids as a novel class of histone deacetylase inhibitors. | ||||
| Ref 527056 | Bioorg Med Chem Lett. 2004 May 17;14(10):2477-81.Stereodefined and polyunsaturated inhibitors of histone deacetylase based on (2E,4E)-5-arylpenta-2,4-dienoic acid hydroxyamides. | ||||
| Ref 527058 | Bioorg Med Chem Lett. 2004 May 17;14(10):2617-20.Three new cyclostellettamines, which inhibit histone deacetylase, from a marine sponge of the genus Xestospongia. | ||||
| Ref 527439 | J Med Chem. 2005 Feb 24;48(4):1019-32.Novel inhibitors of human histone deacetylases: design, synthesis, enzyme inhibition, and cancer cell growth inhibition of SAHA-based non-hydroxamates. | ||||
| Ref 527500 | Bioorg Med Chem Lett. 2005 Apr 15;15(8):1969-72.Mercaptoamide-based non-hydroxamic acid type histone deacetylase inhibitors. | ||||
| Ref 527691 | J Med Chem. 2005 Aug 25;48(17):5530-5.Structure-based optimization of phenylbutyrate-derived histone deacetylase inhibitors. | ||||
| Ref 527980 | J Med Chem. 2006 Jan 26;49(2):800-5.Aromatic sulfide inhibitors of histone deacetylase based on arylsulfinyl-2,4-hexadienoic acid hydroxyamides. | ||||
| Ref 528719 | Bioorg Med Chem Lett. 2007 May 15;17(10):2874-8. Epub 2007 Feb 25.Design and evaluation of 'Linkerless' hydroxamic acids as selective HDAC8 inhibitors. | ||||
| Ref 529285 | J Med Chem. 2008 Mar 27;51(6):1505-29. Epub 2008 Feb 5.Histone deacetylase inhibitors: from bench to clinic. | ||||
| Ref 529333 | Bioorg Med Chem Lett. 2008 Mar 15;18(6):1893-7. Epub 2008 Feb 8.New sulfurated derivatives of valproic acid with enhanced histone deacetylase inhibitory activity. | ||||
| Ref 529875 | J Med Chem. 2009 Jan 22;52(2):456-68.Non-peptide macrocyclic histone deacetylase inhibitors. | ||||
| Ref 530016 | Bioorg Med Chem Lett. 2009 Apr 15;19(8):2346-9. Epub 2009 Feb 12.N-Hydroxy-(4-oxime)-cinnamide: a versatile scaffold for the synthesis of novel histone deacetylase [correction of deacetilase] (HDAC)inhibitors. | ||||
| Ref 530619 | Selective inhibition of histone deacetylases sensitizes malignant cells to death receptor ligands. Mol Cancer Ther. 2010 Jan;9(1):246-56. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
