Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T00884
|
||||
| Former ID |
TTDC00190
|
||||
| Target Name |
High affinity interleukin-8 receptor A
|
||||
| Gene Name |
CXCR1
|
||||
| Synonyms |
CDw128a; CXCR-1; IL-8 receptor type 1; IL-8R A; Interleukin-8 receptor A; CXCR1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Gout [ICD9: 274.00274.1274.8274.9; ICD10: M10] | ||||
| Ischemia-reperfusion injury; Lung transplantation; Graft rejection in heart transplantation [ICD9: 996, 996.84; ICD10: T86, T86.81] | |||||
| Function |
Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor. Binding of il-8 to the receptor causes activation of neutrophils. This response is mediated via a g-protein that activate a phosphatidylinositol-calcium second messenger system.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T00884
|
||||
| UniProt ID | |||||
| Sequence |
MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLV
MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL |
||||
| Structure |
1ILP; 1ILQ; 2LNL
|
||||
| Drugs and Mode of Action | |||||
| Inhibitor | (R)-2-(4-Isobutyl-phenyl)-N-methoxy-propionamide | Drug Info | [527602] | ||
| (R)-2-(4-Isobutyl-phenyl)-propionamide | Drug Info | [527602] | |||
| (R)-3-(4-Isobutyl-phenyl)-butan-2-one | Drug Info | [527602] | |||
| (R)-N-Hydroxy-2-(4-isobutyl-phenyl)-propionamide | Drug Info | [527602] | |||
| 1-(2-Bromo-phenyl)-3-(2,4-dihydroxy-phenyl)-urea | Drug Info | [527139] | |||
| 1-(2-hydroxy-4-nitrophenyl)-3-phenylurea | Drug Info | [526980] | |||
| 2-(3-Isobutyl-phenyl)-propionic acid | Drug Info | [527602] | |||
| 2-(3-Isopropyl-phenyl)-propionic acid | Drug Info | [527602] | |||
| 2-[3-(1-Hydroxy-propyl)-phenyl]-propionic acid | Drug Info | [527602] | |||
| 2-[3-(1-Phenyl-ethyl)-phenyl]-propionic acid | Drug Info | [527602] | |||
| 2-[3-(2-Methyl-butyl)-phenyl]-propionic acid | Drug Info | [527602] | |||
| IBUPROPHEN | Drug Info | [527602] | |||
| INDOPROFEN | Drug Info | [527602] | |||
| R-KETOPROFEN | Drug Info | [527602] | |||
| RAPARIXIN | Drug Info | [527602] | |||
| Agonist | Il-8((3-73))K11R | Drug Info | [535238] | ||
| Modulator | Reparixin | Drug Info | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
| Chemokine signaling pathway | |||||
| Endocytosis | |||||
| Epithelial cell signaling in Helicobacter pylori infection | |||||
| NetPath Pathway | IL2 Signaling Pathway | ||||
| PANTHER Pathway | Inflammation mediated by chemokine and cytokine signaling pathway | ||||
| Interleukin signaling pathway | |||||
| Pathway Interaction Database | IL8- and CXCR1-mediated signaling events | ||||
| Reactome | Chemokine receptors bind chemokines | ||||
| G alpha (i) signalling events | |||||
| WikiPathways | GPCRs, Class A Rhodopsin-like | ||||
| Differentiation Pathway | |||||
| Peptide GPCRs | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| GPCRs, Other | |||||
| References | |||||
| Ref 537129 | New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21. | ||||
| Ref 543171 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8498). | ||||
| Ref 526980 | J Med Chem. 2004 Mar 11;47(6):1319-21.Evaluation of potent and selective small-molecule antagonists for the CXCR2 chemokine receptor. | ||||
| Ref 527139 | Bioorg Med Chem Lett. 2004 Aug 16;14(16):4307-11.Synthesis and structure-activity relationships of 3,5-diarylisoxazoles and 3,5-diaryl-1,2,4-oxadiazoles, novel classes of small molecule interleukin-8(IL-8) receptor antagonists. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
