Target General Infomation
Target ID
T02752
Former ID
TTDC00207
Target Name
C-C chemokine receptor type 3
Gene Name
CCR3
Synonyms
C-C CKR-3; CC-CKR-3; CCR-3; CKR3; Chemokine receptor CCR3; Eosinophil eotaxin receptor; CCR3
Target Type
Research
Disease Allergic rhinitis [ICD9: 472.0, 477, 995.3; ICD10: J00, J30, J31.0, T78.4]
Asthma [ICD10: J45]
Function
Receptor for a C-C type chemokine. Binds to eotaxin, eotaxin-3, MCP-3, MCP-4, RANTES and MIP-1 delta. Subsequently transduces a signal by increasing the intracellular calcium ions level. Alternative coreceptor with CD4 for HIV-1 infection.
BioChemical Class
GPCR rhodopsin
Target Validation
T02752
UniProt ID
Sequence
MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILI
KYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEE
TLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTLLRCPSKKKYKAIRL
IFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLVMLVTEVIAYSHCCMNPVI
YAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF
Drugs and Mode of Action
Drug(s) YM-344031 Drug Info Preclinical Asthma [536958]
YM-355179 Drug Info Preclinical Asthma [536958], [542846]
AZD-1744 Drug Info Discontinued in Phase 1 Asthma [548471]
DPC-168 Drug Info Discontinued in Phase 1 Allergic rhinitis [547358]
QAP-642 Drug Info Terminated Allergic rhinitis [548218]
Modulator AZD-1744 Drug Info [1572591]
Antagonist DPC-168 Drug Info [528777]
QAP-642 Drug Info [551842]
YM-344031 Drug Info [536958]
YM-355179 Drug Info [536958]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Viral carcinogenesis
NetPath Pathway IL3 Signaling Pathway
PANTHER Pathway Inflammation mediated by chemokine and cytokine signaling pathway
Reactome Chemokine receptors bind chemokines
G alpha (i) signalling events
WikiPathways GPCRs, Class A Rhodopsin-like
IL1 and megakaryotyces in obesity
IL-3 Signaling Pathway
Peptide GPCRs
GPCR ligand binding
GPCR downstream signaling
References
Ref 536958Emerging drugs for asthma. Expert Opin Emerg Drugs. 2008 Dec;13(4):643-53.
Ref 542846(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 793).
Ref 547358Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015460)
Ref 548218Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023202)
Ref 548471Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025772)
Ref
Ref 528777CC chemokine receptor-3 (CCR3) antagonists: improving the selectivity of DPC168 by reducing central ring lipophilicity. Bioorg Med Chem Lett. 2007 Jun 1;17(11):2992-7. Epub 2007 Mar 24.
Ref 536958Emerging drugs for asthma. Expert Opin Emerg Drugs. 2008 Dec;13(4):643-53.
Ref 551842New Drugs and Targets for Asthma and COPD. T.T. Hansel, P.J. Barnes. 2010. Page 158.
Ref 1572591Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.