Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T07217
|
||||
| Former ID |
TTDR00476
|
||||
| Target Name |
Fatty acid-binding protein, adipocyte
|
||||
| Gene Name |
FABP4
|
||||
| Synonyms |
A-FABP; AFABP; ALBP; AP2; Adipocyte fatty binding protein; Adipocyte fatty-acid-binding protein; Adipocyte lipid-binding protein; FABP4
|
||||
| Target Type |
Research
|
||||
| Function |
Lipid transport protein in adipocytes. Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus (By similarity).
|
||||
| BioChemical Class |
Calycin family
|
||||
| Target Validation |
T07217
|
||||
| UniProt ID | |||||
| Sequence |
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM KGVTSTRVYERA |
||||
| Inhibitor | 1-benzyl-2,3-dimethyl-1H-indole-7-carboxylic acid | Drug Info | [529963] | ||
| 2-(2,3-bis(2-chlorobenzyloxy)phenyl)acetic acid | Drug Info | [528353] | |||
| 2-(3-Methyl-indole-1-sulfonyl)-benzoic acid | Drug Info | [527208] | |||
| 2-(4-Fluoro-indole-1-sulfonyl)-benzoic acid | Drug Info | [527208] | |||
| 2-(4-Methyl-indole-1-sulfonyl)-benzoic acid | Drug Info | [527208] | |||
| 2-(5-Bromo-indole-1-sulfonyl)-benzoic acid | Drug Info | [527208] | |||
| 2-(6-Methoxy-indole-1-sulfonyl)-benzoic acid | Drug Info | [527208] | |||
| 2-(Carbazole-9-sulfonyl)-benzoic acid | Drug Info | [527208] | |||
| 3-Carbazol-9-yl-propionic acid | Drug Info | [527208] | |||
| 4-Carbazol-9-yl-butyric acid | Drug Info | [527208] | |||
| 5-Carbazol-9-yl-pentanoic acid | Drug Info | [527208] | |||
| BMS-480404 | Drug Info | [528353] | |||
| Hexadecanoic acid | Drug Info | [527208] | |||
| LINOLEIC ACID | Drug Info | [530916] | |||
| OLEIC ACID | Drug Info | [530916] | |||
| Pathways | |||||
| KEGG Pathway | PPAR signaling pathway | ||||
| NetPath Pathway | TCR Signaling Pathway | ||||
| Pathway Interaction Database | AP-1 transcription factor network | ||||
| Reactome | Hormone-sensitive lipase (HSL)-mediated triacylglycerol hydrolysis | ||||
| Transcriptional regulation of white adipocyte differentiation | |||||
| WikiPathways | Lipid digestion, mobilization, and transport | ||||
| Transcriptional Regulation of White Adipocyte Differentiation | |||||
| References | |||||
| Ref 527208 | Bioorg Med Chem Lett. 2004 Sep 6;14(17):4445-8.Discovery of inhibitors of human adipocyte fatty acid-binding protein, a potential type 2 diabetes target. | ||||
| Ref 528353 | J Med Chem. 2006 Aug 10;49(16):5013-7.NMR structure of a potent small molecule inhibitor bound to human keratinocyte fatty acid-binding protein. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
