Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T10052
|
||||
| Former ID |
TTDR00786
|
||||
| Target Name |
G1/S-specific cyclin E1
|
||||
| Gene Name |
CCNE1
|
||||
| Synonyms |
Cyclin E; G1/S-specific cyclin E; CCNE1
|
||||
| Target Type |
Discontinued
|
||||
| Disease | Retinoblastoma [ICD10: C69.2] | ||||
| Function |
Essential for the control of the cell cycle at the G1/S (start) transition.
|
||||
| Target Validation |
T10052
|
||||
| UniProt ID | |||||
| Sequence |
MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQ
PWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIM LNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ ENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWR LSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNI QTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | (2'Z,3'E)-5-Chloro-5'-chloro-indirubin-3'-oxime | Drug Info | [530823] | ||
| (2'Z,3'E)-5-Chloro-5'-fluoro-indirubin-3'-oxime | Drug Info | [530823] | |||
| (2'Z,3'E)-5-Chloro-5'-hydroxy-indirubin-3'-oxime | Drug Info | [530823] | |||
| (2'Z,3'E)-5-Chloro-5'-methyl-indirubin-3'-oxime | Drug Info | [530823] | |||
| (2'Z,3'E)-5-Fluoro-5'-chloro-indirubin-3'-oxime | Drug Info | [530823] | |||
| (2'Z,3'E)-5-Fluoro-5'-fluoro-indirubin-3'-oxime | Drug Info | [530823] | |||
| (2'Z,3'E)-5-Fluoro-5'-hydroxy-indirubin-3'-oxime | Drug Info | [530823] | |||
| (2'Z,3'E)-5-Fluoro-5'-methoxy-indirubin-3'-oxime | Drug Info | [530823] | |||
| (2'Z,3'E)-5-Fluoro-5'-methyl-indirubin-3'-oxime | Drug Info | [530823] | |||
| (2'Z,3'E)-5-Nitro-5'-chloro-indirubin-3'-oxime | Drug Info | [530823] | |||
| (2'Z,3'E)-5-Nitro-5'-fluoro-indirubin-3'-oxime | Drug Info | [530823] | |||
| (2'Z,3'E)-5-Nitro-5'-hydroxy-indirubin-3'-oxime | Drug Info | [530823] | |||
| (2'Z,3'E)-5-Nitro-5'-methoxy-indirubin-3'-oxime | Drug Info | [530823] | |||
| (2'Z,3'E)-5-Nitro-5'-methyl-indirubin-3'-oxime | Drug Info | [530823] | |||
| 2-((3,5-diamino-1H-pyrazol-4-yl)diazenyl)phenol | Drug Info | [528490] | |||
| 3,4-di-(4-methoxyphenyl)-1H-pyrrole-2,5-dione | Drug Info | [528032] | |||
| 3,4-diphenyl-1H-pyrrole-2,5-dione | Drug Info | [528032] | |||
| 3-((3,5-diamino-1H-pyrazol-4-yl)diazenyl)phenol | Drug Info | [528490] | |||
| 3-(4-methoxyphenyl)-4-phenyl-1H-pyrrole-2,5-dione | Drug Info | [528032] | |||
| 3-(indole-3-yl)-4-phenyl-1H-pyrrole-2,5-dione | Drug Info | [528032] | |||
| 4-(7-Butyl-5H-pyrrolo[2,3-b]pyrazin-6-yl)-phenol | Drug Info | [526504] | |||
| 4-[(3,5-diamino-1H-pyrazol-4-yl)diazenyl]phenol | Drug Info | [528490] | |||
| 5-nitroindirubin-3'-oxime | Drug Info | [530823] | |||
| BMS-536924 | Drug Info | [527711] | |||
| PD-0183812 | Drug Info | [525924] | |||
| Pathways | |||||
| KEGG Pathway | Cell cycle | ||||
| Oocyte meiosis | |||||
| p53 signaling pathway | |||||
| PI3K-Akt signaling pathway | |||||
| Hepatitis B | |||||
| Measles | |||||
| Pathways in cancer | |||||
| Viral carcinogenesis | |||||
| MicroRNAs in cancer | |||||
| Prostate cancer | |||||
| Small cell lung cancer | |||||
| NetPath Pathway | IL2 Signaling Pathway | ||||
| TCR Signaling Pathway | |||||
| PANTHER Pathway | Cell cycle | ||||
| Parkinson disease | |||||
| p53 pathway | |||||
| p53 pathway feedback loops 2 | |||||
| Pathway Interaction Database | Signaling events mediated by PRL | ||||
| E2F transcription factor network | |||||
| mTOR signaling pathway | |||||
| FOXM1 transcription factor network | |||||
| BARD1 signaling events | |||||
| PLK3 signaling events | |||||
| Regulation of retinoblastoma protein | |||||
| Reactome | E2F mediated regulation of DNA replication | ||||
| G0 and Early G1 | |||||
| SCF(Skp2)-mediated degradation of p27/p21 | |||||
| DNA Damage/Telomere Stress Induced Senescence | |||||
| Cyclin E associated events during G1/S transition | |||||
| G1/S-Specific Transcription | |||||
| p53-Dependent G1 DNA Damage Response | |||||
| WikiPathways | DNA Damage Response | ||||
| ID signaling pathway | |||||
| G1 to S cell cycle control | |||||
| Retinoblastoma (RB) in Cancer | |||||
| Integrated Pancreatic Cancer Pathway | |||||
| Parkinsons Disease Pathway | |||||
| Parkin-Ubiquitin Proteasomal System pathway | |||||
| Signaling Pathways in Glioblastoma | |||||
| TSH signaling pathway | |||||
| Mitotic G1-G1/S phases | |||||
| Cell Cycle | |||||
| miRNAs involved in DNA damage response | |||||
| miRNA Regulation of DNA Damage Response | |||||
| Androgen receptor signaling pathway | |||||
| References | |||||
| Ref 525924 | J Med Chem. 2000 Nov 30;43(24):4606-16.Pyrido[2,3-d]pyrimidin-7-one inhibitors of cyclin-dependent kinases. | ||||
| Ref 526504 | J Med Chem. 2003 Jan 16;46(2):222-36.Aloisines, a new family of CDK/GSK-3 inhibitors. SAR study, crystal structure in complex with CDK2, enzyme selectivity, and cellular effects. | ||||
| Ref 527711 | J Med Chem. 2005 Sep 8;48(18):5639-43.Discovery of a (1H-benzoimidazol-2-yl)-1H-pyridin-2-one (BMS-536924) inhibitor of insulin-like growth factor I receptor kinase with in vivo antitumor activity. | ||||
| Ref 528032 | J Med Chem. 2006 Feb 23;49(4):1271-81.Design, synthesis, and biological evaluation of 3,4-diarylmaleimides as angiogenesis inhibitors. | ||||
| Ref 528490 | J Med Chem. 2006 Nov 2;49(22):6500-9.4-arylazo-3,5-diamino-1H-pyrazole CDK inhibitors: SAR study, crystal structure in complex with CDK2, selectivity, and cellular effects. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
