Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T14912
|
||||
| Former ID |
TTDC00048
|
||||
| Target Name |
Induced myeloid leukemia cell differentiation protein Mcl-1
|
||||
| Gene Name |
MCL1
|
||||
| Synonyms |
Bcl-2-related protein EAT/mcl1; mcl1/EAT; MCL1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Trematode infection [ICD10: B66.9] | |||||
| BioChemical Class |
Bcl-2 family
|
||||
| Target Validation |
T14912
|
||||
| UniProt ID | |||||
| Sequence |
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | ALTENUSIN | Drug Info | [531262] | ||
| AMENTOFLAVONE | Drug Info | [531262] | |||
| BITHIONOL | Drug Info | [531262] | |||
| CEPHALOCHROMIN | Drug Info | [531262] | |||
| EU-517 | Drug Info | [543733] | |||
| GNF-PF-1591 | Drug Info | [531262] | |||
| GNF-PF-3955 | Drug Info | [531262] | |||
| GNF-PF-5134 | Drug Info | [531262] | |||
| MORIN | Drug Info | [531262] | |||
| NSC-180246 | Drug Info | [531262] | |||
| NSC-66209 | Drug Info | [531262] | |||
| Obatoclax | Drug Info | [531104] | |||
| QEDIIRNIARHLAQVGDSMDR | Drug Info | [528469] | |||
| ROSMARINIC ACID | Drug Info | [531262] | |||
| SULFURETIN | Drug Info | [531262] | |||
| TW-37 | Drug Info | [528469] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | PI3K-Akt signaling pathway | ||||
| MicroRNAs in cancer | |||||
| NetPath Pathway | TCR Signaling Pathway | ||||
| PANTHER Pathway | Apoptosis signaling pathway | ||||
| CCKR signaling map ST | |||||
| Pathway Interaction Database | E2F transcription factor network | ||||
| Direct p53 effectors | |||||
| IL6-mediated signaling events | |||||
| HIF-1-alpha transcription factor network | |||||
| WikiPathways | Apoptosis | ||||
| miR-targeted genes in muscle cell - TarBase | |||||
| miR-targeted genes in lymphocytes - TarBase | |||||
| miR-targeted genes in leukocytes - TarBase | |||||
| Apoptosis Modulation and Signaling | |||||
| References | |||||
| Ref 531104 | Phase II study of obatoclax mesylate (GX15-070), a small-molecule BCL-2 family antagonist, for patients with myelofibrosis. Clin Lymphoma Myeloma Leuk. 2010 Aug;10(4):285-9. | ||||
| Ref 528469 | J Med Chem. 2006 Oct 19;49(21):6139-42.Structure-based design of potent small-molecule inhibitors of anti-apoptotic Bcl-2 proteins. | ||||
| Ref 531104 | Phase II study of obatoclax mesylate (GX15-070), a small-molecule BCL-2 family antagonist, for patients with myelofibrosis. Clin Lymphoma Myeloma Leuk. 2010 Aug;10(4):285-9. | ||||
| Ref 531262 | Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6. Epub 2010 Oct 21.In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
