Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T16340
|
||||
| Former ID |
TTDI01935
|
||||
| Target Name |
Interleukin-1 alpha ligand
|
||||
| Gene Name |
IL1A
|
||||
| Synonyms |
Hematopoietin1; IL1 alpha; Interleukin1 alpha; IL1A
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Atherosclerosis [ICD9: 414.0, 440; ICD10: I70] | ||||
| Osteoarthritis [ICD9: 715; ICD10: M15-M19, M47] | |||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
|
||||
| BioChemical Class |
Cytokine: interleukin
|
||||
| UniProt ID | |||||
| Sequence |
MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETS
KTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLS NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKI TVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHP NLFIATKQDYWVCLAGGPPSITDFQILENQA |
||||
| Drugs and Mode of Action | |||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | MAPK signaling pathway | ||||
| Cytokine-cytokine receptor interaction | |||||
| Apoptosis | |||||
| Osteoclast differentiation | |||||
| Hematopoietic cell lineage | |||||
| Non-alcoholic fatty liver disease (NAFLD) | |||||
| Type I diabetes mellitus | |||||
| Prion diseases | |||||
| Salmonella infection | |||||
| Pertussis | |||||
| Leishmaniasis | |||||
| Tuberculosis | |||||
| Measles | |||||
| Influenza A | |||||
| Inflammatory bowel disease (IBD) | |||||
| Rheumatoid arthritis | |||||
| Graft-versus-host disease | |||||
| NetPath Pathway | IL5 Signaling Pathway | ||||
| IL1 Signaling Pathway | |||||
| TCR Signaling Pathway | |||||
| PANTHER Pathway | Interleukin signaling pathway | ||||
| Pathway Interaction Database | IL1-mediated signaling events | ||||
| Validated transcriptional targets of deltaNp63 isoforms | |||||
| a6b1 and a6b4 Integrin signaling | |||||
| Reactome | Senescence-Associated Secretory Phenotype (SASP) | ||||
| Interleukin-1 signaling | |||||
| Interleukin-1 processing | |||||
| WikiPathways | SIDS Susceptibility Pathways | ||||
| TCR Signaling Pathway | |||||
| Senescence and Autophagy in Cancer | |||||
| Cytokines and Inflammatory Response | |||||
| Hypertrophy Model | |||||
| MAPK Signaling Pathway | |||||
| FAS pathway and Stress induction of HSP regulation | |||||
| Hematopoietic Stem Cell Differentiation | |||||
| Structural Pathway of Interleukin 1 (IL-1) | |||||
| Spinal Cord Injury | |||||
| Allograft Rejection | |||||
| IL-1 signaling pathway | |||||
| Interleukin-1 signaling | |||||
| References | |||||
| Ref 545177 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002363) | ||||
| Ref 548077 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021743) | ||||
| Ref 532430 | Inhibition of interleukin-1 release by IX 207-887. Agents Actions. 1990 Jun;30(3-4):350-62. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
