Target General Infomation
Target ID
T22658
Former ID
TTDR00205
Target Name
Interleukin-8
Gene Name
CXCL8
Synonyms
Emoctakin; GCP-1; Granulocyte chemotacticprotein 1; IL-8; LYNAP; Lymphocyte-derived neutrophil-activating factor; MDNCF; MONAP; Monocyte derived neutrophil activating peptide; Monocyte-derived neutrophil chemotactic factor; NAF; NAP-1; Neutrophil-activating factor; Neutrophil-activating protein 1; Protein 3-10C; T-cell chemotactic factor; CXCL8
Target Type
Clinical Trial
Disease Autoimmune diabetes [ICD10: E08-E13]
Melanoma [ICD9: 172; ICD10: C43]
Function
Il-8 is a chemotactic factor that attracts neutrophils, basophils, and t-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
BioChemical Class
Intercrine-alpha family
Target Validation
T22658
UniProt ID
Sequence
MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Drugs and Mode of Action
Drug(s) ABX-IL8 Drug Info Phase 2 Melanoma [521511]
MDX-018 Drug Info Phase 1 Autoimmune diabetes [550805]
R-KETOPROFEN Drug Info Discontinued in Phase 2 Discovery agent [546255]
Inhibitor 2-(2-(2,5-dichlorophenylamino)phenyl)acetic acid Drug Info [530235]
2-(2-(2-chlorophenoxy)phenyl)acetic acid Drug Info [530235]
2-(2-(2-chlorophenylamino)phenyl)acetic acid Drug Info [530235]
2-(2-(2-fluorophenoxy)phenyl)acetic acid Drug Info [530235]
2-(2-(2-fluorophenylamino)phenyl)acetic acid Drug Info [530235]
IBUPROPHEN Drug Info [530235]
R-KETOPROFEN Drug Info [530235]
Modulator MDX-018 Drug Info
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cytokine-cytokine receptor interaction
Chemokine signaling pathway
NF-kappa B signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Salmonella infection
Pertussis
Legionellosis
Chagas disease (American trypanosomiasis)
Malaria
Amoebiasis
Hepatitis C
Hepatitis B
Influenza A
Pathways in cancer
Transcriptional misregulation in cancer
Bladder cancer
Rheumatoid arthritis
NetPath Pathway IL-7 Signaling Pathway
IL5 Signaling Pathway
IL1 Signaling Pathway
TSH Signaling Pathway
IL2 Signaling Pathway
IL3 Signaling Pathway
IL4 Signaling Pathway
TNFalpha Signaling Pathway
TSLP Signaling Pathway
TCR Signaling Pathway
PANTHER Pathway Inflammation mediated by chemokine and cytokine signaling pathway
Interleukin signaling pathway
CCKR signaling map ST
Pathway Interaction Database LPA receptor mediated events
Calcineurin-regulated NFAT-dependent transcription in lymphocytes
Validated transcriptional targets of AP1 family members Fra1 and Fra2
Glucocorticoid receptor regulatory network
ATF-2 transcription factor network
IL8-mediated signaling events
AP-1 transcription factor network
IL8- and CXCR2-mediated signaling events
Regulation of nuclear beta catenin signaling and target gene transcription
Syndecan-2-mediated signaling events
Syndecan-3-mediated signaling events
IL8- and CXCR1-mediated signaling events
Reactome Senescence-Associated Secretory Phenotype (SASP)
Peptide ligand-binding receptors
Chemokine receptors bind chemokines
ATF4 activates genes
G alpha (i) signalling events
WikiPathways Toll-like receptor signaling pathway
SIDS Susceptibility Pathways
Senescence and Autophagy in Cancer
IL-3 Signaling Pathway
Bladder Cancer
Activation of Genes by ATF4
EBV LMP1 signaling
Spinal Cord Injury
Corticotropin-releasing hormone
Allograft Rejection
TSLP Signaling Pathway
GPCR ligand binding
GPCR downstream signaling
Regulation of toll-like receptor signaling pathway
References
Ref 521511ClinicalTrials.gov (NCT00035828) A Blinded Study Comparing the Safety and Efficacy of a Fully Human Anti-IL8 Monoclonal Antibody (ABX-IL8) to Placebo in Patients With Chronic Bronchitis and COPD. U.S. National Institutes of Health.
Ref 546255Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007136)
Ref 550805Clinical pipeline report, company report or official report of Genmab.
Ref 530235Bioorg Med Chem Lett. 2009 Aug 1;19(15):4026-30. Epub 2009 Jun 13.Structure-Activity Relationship of novel phenylacetic CXCR1 inhibitors.
Ref 535504Fully humanized neutralizing antibodies to interleukin-8 (ABX-IL8) inhibit angiogenesis, tumor growth, and metastasis of human melanoma. Am J Pathol. 2002 Jul;161(1):125-34.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.