Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T31621
|
||||
| Former ID |
TTDR00567
|
||||
| Target Name |
Heparin-binding growth factor 2
|
||||
| Gene Name |
FGF2
|
||||
| Synonyms |
BFGF; Basic fibroblast growth factor; FGF-2; Fibroblast growth factor 2; HBGF-2; Prostatropin; FGF2
|
||||
| Target Type |
Successful
|
||||
| Disease | Acne vulgaris [ICD9: 706.1; ICD10: L70.0] | ||||
| Arteriosclerosis [ICD9: 440; ICD10: I70] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Diabetic retinopathy [ICD9: 250.5; ICD10: H36, E10.3, E11.3, E13.3] | |||||
| Multiple myeloma [ICD9: 203; ICD10: C90] | |||||
| Neurodegenerative disease [ICD9: 330-337; ICD10: G30-G32] | |||||
| Function |
The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.
|
||||
| BioChemical Class |
Heparin-binding growth factors family
|
||||
| UniProt ID | |||||
| Sequence |
MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA
GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
||||
| Structure |
1BAS; 1BFB; 1BFC; 1BFF; 1BFG; 1BLA; 1BLD; 1CVS; 1EV2; 1FGA; 1FQ9; 1II4; 1IIL; 2BFH; 2FGF; 2M49; 4FGF; 4OEE; 4OEF; 4OEG
|
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Sucralfate | Drug Info | Approved | Acne vulgaris | [523336], [542066], [551871] |
| Squalamine | Drug Info | Phase 3 | Cancer | [521667] | |
| DVC1-0101 | Drug Info | Phase 2 | Arteriosclerosis | [532195] | |
| TGP-580 | Drug Info | Discontinued in Phase 2 | Neurodegenerative disease | [545028] | |
| RG-8803 | Drug Info | Terminated | Diabetic retinopathy | [546922] | |
| Inhibitor | 1,4-Dideoxy-5-Dehydro-O2-Sulfo-Glucuronic Acid | Drug Info | [551393] | ||
| 1,4-Dideoxy-O2-Sulfo-Glucuronic Acid | Drug Info | [551393] | |||
| Beta-Mercaptoethanol | Drug Info | [551393] | |||
| BIBF100 | Drug Info | [537114] | |||
| N,O6-Disulfo-Glucosamine | Drug Info | [551393] | |||
| RG-8803 | Drug Info | [551906] | |||
| Modulator | DVC1-0101 | Drug Info | [532195] | ||
| Squalamine | Drug Info | [551462] | |||
| Sucralfate | Drug Info | [533712], [551871] | |||
| TGP-580 | Drug Info | [525608] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | MAPK signaling pathway | ||||
| Ras signaling pathway | |||||
| Rap1 signaling pathway | |||||
| PI3K-Akt signaling pathway | |||||
| Signaling pathways regulating pluripotency of stem cells | |||||
| Regulation of actin cytoskeleton | |||||
| Pathways in cancer | |||||
| Proteoglycans in cancer | |||||
| Melanoma | |||||
| NetPath Pathway | IL1 Signaling Pathway | ||||
| Pathway Interaction Database | Glypican 1 network | ||||
| Angiopoietin receptor Tie2-mediated signaling | |||||
| Integrins in angiogenesis | |||||
| Syndecan-4-mediated signaling events | |||||
| FGF signaling pathway | |||||
| Reactome | PI3K Cascade | ||||
| PIP3 activates AKT signaling | |||||
| FGFR4 ligand binding and activation | |||||
| FGFR3c ligand binding and activation | |||||
| FGFR2c ligand binding and activation | |||||
| FGFR2b ligand binding and activation | |||||
| FGFR3 mutant receptor activation | |||||
| Activated point mutants of FGFR2 | |||||
| Constitutive Signaling by Aberrant PI3K in Cancer | |||||
| POU5F1 (OCT4), SOX2, NANOG activate genes related to proliferation | |||||
| Syndecan interactions | |||||
| Non-integrin membrane-ECM interactions | |||||
| FGFR1 | |||||
| Phospholipase C-mediated cascade | |||||
| Phospholipase C-mediated cascade | |||||
| Phospholipase C-mediated cascade | |||||
| FGFR1 | |||||
| FGFR1 | |||||
| FRS-mediated FGFR1 signaling | |||||
| FGFR2 | |||||
| FGFR2 | |||||
| FRS-mediated FGFR2 signaling | |||||
| FGFR3 | |||||
| FRS-mediated FGFR3 signaling | |||||
| FGFR3 | |||||
| FRS-mediated FGFR4 signaling | |||||
| FGFR4 | |||||
| FGFR4 | |||||
| Negative regulation of FGFR1 signaling | |||||
| Negative regulation of FGFR2 signaling | |||||
| Negative regulation of FGFR3 signaling | |||||
| Negative regulation of FGFR4 signaling | |||||
| RAF/MAP kinase cascade | |||||
| WikiPathways | Regulation of Actin Cytoskeleton | ||||
| Endochondral Ossification | |||||
| Differentiation Pathway | |||||
| Cardiac Hypertrophic Response | |||||
| Syndecan interactions | |||||
| Extracellular matrix organization | |||||
| Signaling by Type 1 Insulin-like Growth Factor 1 Receptor (IGF1R) | |||||
| PIP3 activates AKT signaling | |||||
| Cardiac Progenitor Differentiation | |||||
| Integrated Pancreatic Cancer Pathway | |||||
| Neural Crest Differentiation | |||||
| miR-targeted genes in squamous cell - TarBase | |||||
| miR-targeted genes in muscle cell - TarBase | |||||
| miR-targeted genes in lymphocytes - TarBase | |||||
| Signaling by FGFR | |||||
| MicroRNAs in cardiomyocyte hypertrophy | |||||
| Angiogenesis | |||||
| References | |||||
| Ref 521667 | ClinicalTrials.gov (NCT00139282) A Safety and Efficacy Study of Squalamine Lactate for Injection (MSI-1256F) for "Wet" Age-Related Macular Degeneration. U.S. National Institutes of Health. | ||||
| Ref 523336 | ClinicalTrials.gov (NCT01284647) A Study to Evaluate the Efficacy of Teprenone On Chinese Patients With Chronic Non-Atrophic Erosive Gastritis. U.S. National Institutes of Health. | ||||
| Ref 532195 | DVC1-0101 to treat peripheral arterial disease: a Phase I/IIa open-label dose-escalation clinical trial. Mol Ther. 2013 Mar;21(3):707-14. | ||||
| Ref 542066 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7055). | ||||
| Ref 545028 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001922) | ||||
| Ref 525608 | Expression of fibroblast growth factor-2 transcripts in the healing of acetic acid-induced gastric ulcers. APMIS. 1999 Aug;107(8):767-72. | ||||
| Ref 532195 | DVC1-0101 to treat peripheral arterial disease: a Phase I/IIa open-label dose-escalation clinical trial. Mol Ther. 2013 Mar;21(3):707-14. | ||||
| Ref 533712 | Assessment of sucralfate coating by sequential scintigraphic imaging in radiation-induced esophageal lesions. Gastrointest Endosc. 1995 Feb;41(2):109-14. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
