Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T46521
|
||||
| Former ID |
TTDC00332
|
||||
| Target Name |
mRNA of androgen receptor
|
||||
| Gene Name |
AR
|
||||
| Synonyms |
mRNA of Dihydrotestosterone receptor; mRNA of Nuclear receptor subfamily 3 group C member 4; AR
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Acne vulgaris [ICD9: 706.1; ICD10: L70.0] | ||||
| Atherosclerosis [ICD9: 414.0, 440; ICD10: I70] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Prostate cancer [ICD9: 185; ICD10: C61] | |||||
| Function |
Steroid hormone receptors are ligand-activated transcription factors that regulate eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Transcription factor activity is modulated by bound coactivator and corepressor proteins. Transcription activation is down-regulated by NR0B2. Activated, but not phosphorylated, by HIPK3 and ZIPK/DAPK3.
|
||||
| BioChemical Class |
Target of antisense drug
|
||||
| Target Validation |
T46521
|
||||
| UniProt ID | |||||
| Sequence |
MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQ
QQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQ SALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSAD LKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELC KAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAG KSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQ SRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAA GPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAP YGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRL ETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRN DCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKL TVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWA KALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSR MYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELD RIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEII SVQVPKILSGKVKPIYFHTQ |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | 1,2-dibromo-4-(1,2-dibromoethyl)cyclohexane | Drug Info | [528558] | ||
| 2'-Hydroxy-3-methoxy-biphenyl-4-carbonitrile | Drug Info | [529750] | |||
| 2-chloro-4-(o-tolyloxy)benzonitrile | Drug Info | [530022] | |||
| 2-methoxy-4-(2-methoxyphenylthio)benzonitrile | Drug Info | [529954] | |||
| 2-methoxy-4-(m-tolyloxy)benzonitrile | Drug Info | [529954] | |||
| 2-methoxy-4-(o-tolyloxy)benzonitrile | Drug Info | [529954] | |||
| 2-methoxy-4-(p-tolyloxy)benzonitrile | Drug Info | [529954] | |||
| 2-methoxy-4-(propylthio)benzonitrile | Drug Info | [529954] | |||
| 3,2'-bis-trifluoromethyl-biphenyl-4-carbonitrile | Drug Info | [529009] | |||
| 3-chloro-4-(o-tolyloxy)benzonitrile | Drug Info | [530022] | |||
| 3-chloro-4-(o-tolylthio)benzonitrile | Drug Info | [529954] | |||
| 3-methoxy-4-(m-tolyloxy)benzonitrile | Drug Info | [529954] | |||
| 3-methoxy-4-(o-tolyloxy)benzonitrile | Drug Info | [529954] | |||
| 3-methoxy-4-(p-tolyloxy)benzonitrile | Drug Info | [529954] | |||
| 4-(2,6-dimethylphenylthio)-2-methoxybenzonitrile | Drug Info | [529954] | |||
| 4-(butylthio)-2-(trifluoromethyl)benzonitrile | Drug Info | [529954] | |||
| 4-(butylthio)-2-methoxybenzonitrile | Drug Info | [529954] | |||
| 4-(cyclobutylmethylthio)-2-methoxybenzonitrile | Drug Info | [529954] | |||
| 4-(cyclopropylmethylthio)-2-methoxybenzonitrile | Drug Info | [529954] | |||
| 4-(isopentylthio)-2-(trifluoromethyl)benzonitrile | Drug Info | [529954] | |||
| 4-(isopentylthio)-2-methoxybenzonitrile | Drug Info | [529954] | |||
| 4-(isopropylthio)-2-(trifluoromethyl)benzonitrile | Drug Info | [529954] | |||
| 4-(isopropylthio)-2-methoxybenzonitrile | Drug Info | [529954] | |||
| 4-(m-tolyloxy)-2-(trifluoromethyl)benzonitrile | Drug Info | [530022] | |||
| 4-(mesityloxy)-2-(trifluoromethyl)benzonitrile | Drug Info | [530022] | |||
| 4-(mesitylthio)-2-(trifluoromethyl)benzonitrile | Drug Info | [529954] | |||
| 4-(mesitylthio)-2-methoxybenzonitrile | Drug Info | [529954] | |||
| 4-(o-tolyloxy)-2-(trifluoromethyl)benzonitrile | Drug Info | [530022] | |||
| 4-(o-tolylthio)-2-(trifluoromethyl)benzonitrile | Drug Info | [529954] | |||
| 4-(p-tolyloxy)-2-(trifluoromethyl)benzonitrile | Drug Info | [530022] | |||
| 4-(propylthio)-2-(trifluoromethyl)benzonitrile | Drug Info | [529954] | |||
| 5-Methoxyflavone | Drug Info | [530256] | |||
| 6-amino-4-trifluoromethylquinolin-2(1H)-one | Drug Info | [528470] | |||
| 6-Hydroxyflavanone | Drug Info | [530256] | |||
| 6-N-propyl -4-trifluoromethylquinolin-2(1H)-one | Drug Info | [528470] | |||
| AL-43 | Drug Info | [526567] | |||
| APIGENIN | Drug Info | [530256] | |||
| BMS-564929 | Drug Info | [530061] | |||
| CP-394531 | Drug Info | [526345] | |||
| CP-409069 | Drug Info | [526345] | |||
| EPIERENONE | Drug Info | [529171] | |||
| EUGENOL | Drug Info | [530785] | |||
| KAEMPFEROL | Drug Info | [530256] | |||
| LG-120838 | Drug Info | [534728] | |||
| LG-121071 | Drug Info | [528792] | |||
| LGD-2226 | Drug Info | [528648] | |||
| LGD-5552 | Drug Info | [529166] | |||
| NSC-19028 | Drug Info | [530256] | |||
| NSC-26745 | Drug Info | [530256] | |||
| PF-0998425 | Drug Info | [529750] | |||
| RU-43044 | Drug Info | [526345] | |||
| RU-56187 | Drug Info | [530839] | |||
| RU-58841 | Drug Info | [529750] | |||
| WAY-252623 | Drug Info | [529781] | |||
| WAY-255348 | Drug Info | [529352] | |||
| YM-175735 | Drug Info | [527978] | |||
| ZK-230211 | Drug Info | [525950] | |||
| Agonist | andarine | Drug Info | [530128] | ||
| [3H]dihydrotestosterone | Drug Info | [543904] | |||
| [3H]methyltrienolone | Drug Info | [543904] | |||
| [3H]mibolerone | Drug Info | [543904] | |||
| Antagonist | bisphenol A | Drug Info | [532398] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Oocyte meiosis | ||||
| Pathways in cancer | |||||
| Prostate cancer | |||||
| NetPath Pathway | EGFR1 Signaling Pathway | ||||
| AndrogenReceptor Signaling Pathway | |||||
| FSH Signaling Pathway | |||||
| Pathway Interaction Database | Regulation of nuclear SMAD2/3 signaling | ||||
| Coregulation of Androgen receptor activity | |||||
| Regulation of Androgen receptor activity | |||||
| Nongenotropic Androgen signaling | |||||
| Regulation of nuclear beta catenin signaling and target gene transcription | |||||
| FOXA1 transcription factor network | |||||
| Notch-mediated HES/HEY network | |||||
| Reactome | Nuclear Receptor transcription pathway | ||||
| Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 | |||||
| WikiPathways | SIDS Susceptibility Pathways | ||||
| Integrated Pancreatic Cancer Pathway | |||||
| Prostate Cancer | |||||
| Integrated Breast Cancer Pathway | |||||
| Nuclear Receptors | |||||
| Androgen receptor signaling pathway | |||||
| References | |||||
| Ref 525950 | J Med Chem. 2000 Dec 28;43(26):5010-6.Synthesis and biological activity of a novel, highly potent progesterone receptor antagonist. | ||||
| Ref 526345 | J Med Chem. 2002 Jun 6;45(12):2417-24.Discovery of potent, nonsteroidal, and highly selective glucocorticoid receptor antagonists. | ||||
| Ref 526567 | J Med Chem. 2003 Mar 13;46(6):1016-30.Nonsteroidal selective glucocorticoid modulators: the effect of C-10 substitution on receptor selectivity and functional potency of 5-allyl-2,5-dihydro-2,2,4-trimethyl-1H-[1]benzopyrano[3,4-f]quinolines. | ||||
| Ref 527978 | J Med Chem. 2006 Jan 26;49(2):716-26.(+)-(2R,5S)-4-[4-cyano-3-(trifluoromethyl)phenyl]-2,5-dimethyl-N-[6-(trifluoromethyl)pyridin-3- yl]piperazine-1-carboxamide (YM580) as an orally potent and peripherally selective nonsteroidal androgen receptor antagonist. | ||||
| Ref 528470 | J Med Chem. 2006 Oct 19;49(21):6143-6.Discovery of 6-N,N-bis(2,2,2-trifluoroethyl)amino- 4-trifluoromethylquinolin-2(1H)-one as a novel selective androgen receptor modulator. | ||||
| Ref 528558 | J Med Chem. 2006 Dec 14;49(25):7366-72.Identification of the brominated flame retardant 1,2-dibromo-4-(1,2-dibromoethyl)cyclohexane as an androgen agonist. | ||||
| Ref 528648 | Bioorg Med Chem Lett. 2007 Mar 15;17(6):1527-31. Epub 2007 Jan 8.Novel selective androgen receptor modulators: SAR studies on 6-bisalkylamino-2-quinolinones. | ||||
| Ref 528792 | J Med Chem. 2007 May 17;50(10):2486-96. Epub 2007 Apr 17.Novel series of potent, nonsteroidal, selective androgen receptor modulators based on 7H-[1,4]oxazino[3,2-g]quinolin-7-ones. | ||||
| Ref 529009 | Bioorg Med Chem Lett. 2007 Oct 15;17(20):5529-32. Epub 2007 Aug 19.Preparation of 4-aryl-2-trifluoromethylbenzonitrile derivatives as androgen receptor antagonists for topical suppression of sebum production. | ||||
| Ref 529166 | Proc Natl Acad Sci U S A. 2007 Dec 4;104(49):19244-9. Epub 2007 Nov 21.Antiinflammatory glucocorticoid receptor ligand with reduced side effects exhibits an altered protein-protein interaction profile. | ||||
| Ref 529171 | J Med Chem. 2007 Dec 27;50(26):6443-5. Epub 2007 Nov 27.(S)-N-{3-[1-cyclopropyl-1-(2,4-difluoro-phenyl)-ethyl]-1H-indol-7-yl}-methanesulfonamide: a potent, nonsteroidal, functional antagonist of themineralocorticoid receptor. | ||||
| Ref 529352 | J Med Chem. 2008 Mar 27;51(6):1861-73. Epub 2008 Mar 5.Design, synthesis, and SAR of new pyrrole-oxindole progesterone receptor modulators leading to 5-(7-fluoro-3,3-dimethyl-2-oxo-2,3-dihydro-1H-indol-5-yl)-1-methyl-1H-pyrrole-2-carbonitrile (WAY-255348). | ||||
| Ref 529750 | J Med Chem. 2008 Nov 13;51(21):7010-4. Epub 2008 Oct 16.Rational design and synthesis of 4-((1R,2R)-2-hydroxycyclohexyl)-2(trifluoromethyl)benzonitrile (PF-998425), a novel, nonsteroidal androgen receptor antagonist devoid of phototoxicity for dermatological indications. | ||||
| Ref 529781 | J Med Chem. 2008 Nov 27;51(22):7161-8.Indazole-based liver X receptor (LXR) modulators with maintained atherosclerotic lesion reduction activity but diminished stimulation of hepatic triglyceride synthesis. | ||||
| Ref 529954 | Bioorg Med Chem Lett. 2009 Mar 1;19(5):1310-3. Epub 2009 Jan 27.4-(Alkylthio)- and 4-(arylthio)-benzonitrile derivatives as androgen receptor antagonists for the topical suppression of sebum production. | ||||
| Ref 530022 | Bioorg Med Chem Lett. 2009 Apr 15;19(8):2176-8. Epub 2009 Mar 3.Diphenyl ethers as androgen receptor antagonists for the topical suppression of sebum production. | ||||
| Ref 530061 | J Med Chem. 2009 May 14;52(9):2794-8.N-aryl-oxazolidin-2-imine muscle selective androgen receptor modulators enhance potency through pharmacophore reorientation. | ||||
| Ref 530128 | Nonsteroidal selective androgen receptor modulators (SARMs): dissociating the anabolic and androgenic activities of the androgen receptor for therapeutic benefit. J Med Chem. 2009 Jun 25;52(12):3597-617. | ||||
| Ref 530256 | Bioorg Med Chem Lett. 2009 Aug 15;19(16):4706-10. Epub 2009 Jun 23.Effect of flavonoids on androgen and glucocorticoid receptors based on in vitro reporter gene assay. | ||||
| Ref 530785 | Bioorg Med Chem Lett. 2010 Apr 1;20(7):2111-4. Epub 2010 Feb 21.Effect of essential oils, such as raspberry ketone and its derivatives, on antiandrogenic activity based on in vitro reporter gene assay. | ||||
| Ref 530839 | Bioorg Med Chem. 2010 May 1;18(9):3159-68. Epub 2010 Mar 19.Structure-activity relationships of bioisosteric replacement of the carboxylic acid in novel androgen receptor pure antagonists. | ||||
| Ref 532398 | Structure-activity relationships of bisphenol A analogs at estrogen receptors (ERs): discovery of an ERalpha-selective antagonist. Bioorg Med Chem Lett. 2013 Jul 15;23(14):4031-6. | ||||
| Ref 534728 | J Med Chem. 1998 Oct 22;41(22):4354-9.5-Benzylidene 1,2-dihydrochromeno[3,4-f]quinolines, a novel class of nonsteroidal human progesterone receptor agonists. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
