Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T48268
|
||||
| Former ID |
TTDS00422
|
||||
| Target Name |
Melatonin receptor type 1B
|
||||
| Gene Name |
MTNR1B
|
||||
| Synonyms |
Mel-1B-R; Mel1b melatonin receptor; MTNR1B
|
||||
| Target Type |
Successful
|
||||
| Disease | Circadian rhythm sleep disorder [ICD9: 327.3, 780.55; ICD10: G47.2] | ||||
| Epilepsy [ICD10: G40] | |||||
| Insomnia [ICD9: 307.41, 307.42, 327.0, 780.51, 780.52; ICD10: F51.0, G47.0] | |||||
| Function |
High affinityreceptor for melatonin. Likely to mediates the reproductive and circadian actions of melatonin. The activity of this receptor is mediated by pertussis toxin sensitive G proteins that inhibit adenylate cyclase activity.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T48268
|
||||
| UniProt ID | |||||
| Sequence |
MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL
VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD AL |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | 5-methoxycarbonylamino-N-acetyltryptamine | Drug Info | [529396] | ||
| Beta,beta-dimethylmelatonin | Drug Info | [528234] | |||
| Beta-methylmelatonin | Drug Info | [528234] | |||
| IODOMELATONIN | Drug Info | [526317] | |||
| N-(2,3,4,9-Tetrahydro-1H-carbazol-3-yl)-acetamide | Drug Info | [551266] | |||
| N-(2-(5-methoxybenzofuran-3-yl)ethyl)acetamide | Drug Info | [529396] | |||
| N-(3-(2,5-dimethoxyphenyl)propyl)acetamide | Drug Info | [530786] | |||
| N-(3-(2-ethoxy-5-methoxyphenyl)propyl)acetamide | Drug Info | [530786] | |||
| N-(3-(2-hydroxy-5-methoxyphenyl)propyl)acetamide | Drug Info | [530786] | |||
| N-(3-(3-methoxyphenyl)-3-phenylallyl)acetamide | Drug Info | [529949] | |||
| N-(3-(3-methoxyphenyl)propyl)acetamide | Drug Info | [530786] | |||
| N-(3-(3-methoxyphenyl)propyl)propionamide | Drug Info | [530786] | |||
| N-(3-(4-hydroxy-3-methoxyphenyl)propyl)acetamide | Drug Info | [530786] | |||
| N-(3-(5-methoxy-2-propoxyphenyl)propyl)acetamide | Drug Info | [530786] | |||
| N-(3-Benzooxazol-7-yl-propyl)-acetamide | Drug Info | [527111] | |||
| N-(3-Benzooxazol-7-yl-propyl)-butyramide | Drug Info | [527111] | |||
| N-(3-Benzooxazol-7-yl-propyl)-propionamide | Drug Info | [527111] | |||
| N-[3-(2-Ethyl-benzooxazol-7-yl)-propyl]-acetamide | Drug Info | [527111] | |||
| UCM-454 | Drug Info | [529949] | |||
| Modulator | Ramelteon | Drug Info | [529337], [532551] | ||
| VLB-01 | Drug Info | [1572591] | |||
| Agonist | Tasimelteon | Drug Info | [542414] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| References | |||||
| Ref 538833 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1356). | ||||
| Ref 542414 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7393). | ||||
| Ref 526317 | J Med Chem. 2002 Apr 25;45(9):1853-9.Synthesis of nitroindole derivatives with high affinity and selectivity for melatoninergic binding sites MT(3). | ||||
| Ref 527111 | Bioorg Med Chem Lett. 2004 Jul 16;14(14):3799-802.Synthesis and structure-activity relationship of novel benzoxazole derivatives as melatonin receptor agonists. | ||||
| Ref 528234 | J Med Chem. 2006 Jun 15;49(12):3509-19.Mapping the melatonin receptor. 7. Subtype selective ligands based on beta-substituted N-acyl-5-methoxytryptamines and beta-substituted N-acyl-5-methoxy-1-methyltryptamines. | ||||
| Ref 529337 | Ramelteon: a melatonin receptor agonist for the treatment of insomnia. J Postgrad Med. 2008 Jan-Mar;54(1):45-8. | ||||
| Ref 529396 | Bioorg Med Chem. 2008 May 1;16(9):4954-62. Epub 2008 Mar 17.Design and synthesis of benzofuranic derivatives as new ligands at the melatonin-binding site MT3. | ||||
| Ref 529949 | J Med Chem. 2009 Feb 12;52(3):826-33.2-[(2,3-dihydro-1H-indol-1-yl)methyl]melatonin analogues: a novel class of MT2-selective melatonin receptor antagonists. | ||||
| Ref 530786 | Bioorg Med Chem Lett. 2010 Apr 15;20(8):2582-5. Epub 2010 Feb 25.Synthesis of substituted N-[3-(3-methoxyphenyl)propyl] amides as highly potent MT(2)-selective melatonin ligands. | ||||
| Ref 532551 | MT1 and MT2 melatonin receptors: ligands, models, oligomers, and therapeutic potential. J Med Chem. 2014 Apr 24;57(8):3161-85. | ||||
| Ref 542414 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7393). | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
