Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T52297
|
||||
| Former ID |
TTDR00420
|
||||
| Target Name |
Oxysterols receptor LXR-alpha
|
||||
| Gene Name |
NR1H3
|
||||
| Synonyms |
LXRalpha; Liver X receptor alpha; Nuclear orphan receptor LXR-alpha; Nuclear receptor LXRalpha; NR1H3
|
||||
| Target Type |
Research
|
||||
| Disease | Atherosclerosis [ICD9: 414.0, 440; ICD10: I70] | ||||
| Function |
Nuclear receptor. Interaction with RXR shifts RXRfrom its role as a silent DNA-binding partner to an active ligand- binding subunit in mediating retinoid responses through target genes defined by LXRES. LXRES are DR4-type response elements characterized by direct repeats of two similar hexanuclotide half- sites spaced by four nucleotides. Plays an important role in the regulation of cholesterol homeostasis, regulating cholesterol uptake throughMYLIP-dependent ubiquitination of LDLR, VLDLR and LRP8. Interplays functionally with RORA for the regulation of genes involved in liver metabolism (By similarity).
|
||||
| BioChemical Class |
Nuclear hormone receptor
|
||||
| Target Validation |
T52297
|
||||
| UniProt ID | |||||
| Sequence |
MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEA
AEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG FFRRSVIKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK RQEEEQAHATSLPPRASSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPM APDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV HSEQVFALRLQDKKLPPLLSEIWDVHE |
||||
| Inhibitor | 12,17-dehydroxyriccardin C | Drug Info | [529375] | ||
| 12-dehydroxyriccardin C | Drug Info | [529375] | |||
| 17-dehydroxyriccardin C | Drug Info | [529375] | |||
| 2-(2-hexylphenyl)isoindoline-1,3-dione | Drug Info | [529375] | |||
| 2-(2-phenethylphenyl)isoindoline-1,3-dione | Drug Info | [530220] | |||
| 2-Benzyl-3-phenyl-7-(trifluoromethyl)-2H-indazole | Drug Info | [529781] | |||
| 2-benzyl-4,5,6,7-tetrachloroisoindoline-1,3-dione | Drug Info | [528834] | |||
| 4,12,17-dehydroxyriccardin C | Drug Info | [529375] | |||
| 4,17-dehydroxyriccardin C | Drug Info | [529375] | |||
| 4-dehydroxyriccardin C | Drug Info | [529375] | |||
| 5-chloro-2-(4-phenylbutyl)isoindoline-1,3-dione | Drug Info | [528834] | |||
| GSK-9772 | Drug Info | [529702] | |||
| Guttiferone I | Drug Info | [527525] | |||
| GW-3965 | Drug Info | [529781] | |||
| N-{4-[2-(3-Hydroxyphenyl)ethyl]phenyl}phthalimide | Drug Info | [530220] | |||
| N-{4-[2-(3-Methoxyphenyl)ethyl]phenyl}phthalimide | Drug Info | [530220] | |||
| N-{4-[2-(4-Hydroxyphenyl)ethyl]phenyl}phthalimide | Drug Info | [530220] | |||
| N-{4-[2-(4-Methoxyphenyl)ethyl]phenyl}phthalimide | Drug Info | [530220] | |||
| Riccardin C | Drug Info | [529375] | |||
| WAY-214950 | Drug Info | [529781] | |||
| WAY-252623 | Drug Info | [529781] | |||
| WAY-254011 | Drug Info | [530094] | |||
| Agonist | 22R-hydroxycholesterol | Drug Info | [534255] | ||
| 24(S), 25-epoxycholesterol | Drug Info | [532179] | |||
| 24(S)-hydroxycholesterol | Drug Info | [534311] | |||
| 27-hydroxycholesterol | Drug Info | [526122] | |||
| acetyl-podocarpic dimer | Drug Info | [526248] | |||
| AZ12260493 | Drug Info | [543894] | |||
| desmosterol | Drug Info | [528328] | |||
| L-783483 | Drug Info | [535486] | |||
| paxilline | Drug Info | [526684] | |||
| Antagonist | GSK2033 | Drug Info | [530809] | ||
| SR9238 | Drug Info | [532155] | |||
| Pathways | |||||
| KEGG Pathway | PPAR signaling pathway | ||||
| Non-alcoholic fatty liver disease (NAFLD) | |||||
| Hepatitis C | |||||
| Pathway Interaction Database | RXR and RAR heterodimerization with other nuclear receptor | ||||
| WikiPathways | Nuclear Receptors in Lipid Metabolism and Toxicity | ||||
| Nuclear Receptors Meta-Pathway | |||||
| PPAR Alpha Pathway | |||||
| Liver X Receptor Pathway | |||||
| Adipogenesis | |||||
| SREBF and miR33 in cholesterol and lipid homeostasis | |||||
| Nuclear Receptors | |||||
| References | |||||
| Ref 526122 | 27-hydroxycholesterol is an endogenous ligand for liver X receptor in cholesterol-loaded cells. J Biol Chem. 2001 Oct 19;276(42):38378-87. Epub 2001 Aug 14. | ||||
| Ref 526248 | A potent synthetic LXR agonist is more effective than cholesterol loading at inducing ABCA1 mRNA and stimulating cholesterol efflux. J Biol Chem. 2002 Mar 22;277(12):10021-7. Epub 2002 Jan 14. | ||||
| Ref 526684 | A natural product ligand of the oxysterol receptor, liver X receptor. J Pharmacol Exp Ther. 2003 Oct;307(1):291-6. Epub 2003 Jul 31. | ||||
| Ref 527525 | J Nat Prod. 2005 Apr;68(4):617-9.Guttiferone I, a new prenylated benzophenone from Garcinia humilis as a liver X receptor ligand. | ||||
| Ref 528328 | Sterol intermediates from cholesterol biosynthetic pathway as liver X receptor ligands. J Biol Chem. 2006 Sep 22;281(38):27816-26. Epub 2006 Jul 20. | ||||
| Ref 528834 | Bioorg Med Chem Lett. 2007 Jul 15;17(14):3957-61. Epub 2007 Apr 30.Liver X receptor antagonists with a phthalimide skeleton derived from thalidomide-related glucosidase inhibitors. | ||||
| Ref 529375 | Bioorg Med Chem. 2008 Apr 15;16(8):4272-85. Epub 2008 Feb 29.Co-existence of alpha-glucosidase-inhibitory and liver X receptor-regulatory activities and their separation by structural development. | ||||
| Ref 529702 | J Med Chem. 2008 Sep 25;51(18):5758-65.Structure-guided design of N-phenyl tertiary amines as transrepression-selective liver X receptor modulators with anti-inflammatory activity. | ||||
| Ref 529781 | J Med Chem. 2008 Nov 27;51(22):7161-8.Indazole-based liver X receptor (LXR) modulators with maintained atherosclerotic lesion reduction activity but diminished stimulation of hepatic triglyceride synthesis. | ||||
| Ref 530094 | Bioorg Med Chem. 2009 May 15;17(10):3519-27. Epub 2009 Apr 12.Discovery and SAR of cinnolines/quinolines as liver X receptor (LXR) agonists with binding selectivity for LXRbeta. | ||||
| Ref 530220 | Bioorg Med Chem. 2009 Jul 15;17(14):5001-14. Epub 2009 Jun 2.Separation of alpha-glucosidase-inhibitory and liver X receptor-antagonistic activities of phenethylphenyl phthalimide analogs and generation of LXRalpha-selective antagonists. | ||||
| Ref 530809 | Discovery of tertiary sulfonamides as potent liver X receptor antagonists. J Med Chem. 2010 Apr 22;53(8):3412-6. | ||||
| Ref 532155 | A liver-selective LXR inverse agonist that suppresses hepatic steatosis. ACS Chem Biol. 2013 Mar 15;8(3):559-67. | ||||
| Ref 532179 | Brain endogenous liver X receptor ligands selectively promote midbrain neurogenesis. Nat Chem Biol. 2013 Feb;9(2):126-33. | ||||
| Ref 534255 | An oxysterol signalling pathway mediated by the nuclear receptor LXR alpha. Nature. 1996 Oct 24;383(6602):728-31. | ||||
| Ref 534311 | Activation of the nuclear receptor LXR by oxysterols defines a new hormone response pathway. J Biol Chem. 1997 Feb 7;272(6):3137-40. | ||||
| Ref 535486 | A novel liver X receptor agonist establishes species differences in the regulation of cholesterol 7alpha-hydroxylase (CYP7a). Endocrinology. 2002 Jul;143(7):2548-58. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
