Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T58093
|
||||
| Former ID |
TTDR00267
|
||||
| Target Name |
Peptide deformylase
|
||||
| Gene Name |
def
|
||||
| Synonyms |
PDF; Polypeptide deformylase; def
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | ||||
| Infection of P. falciparum [ICD9: 84; ICD10: B50-B54] | |||||
| Function |
Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions (By similarity).
|
||||
| BioChemical Class |
Carbon-nitrogen hydrolase
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.5.1.88
|
||||
| Sequence |
MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVG
LAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAG LVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDA VEV |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | 2-(3-BENZOYLPHENOXY)ETHYL(HYDROXY)FORMAMIDE | Drug Info | [551374] | ||
| 3-Sulfinoalanine | Drug Info | [551393] | |||
| Actinonin | Drug Info | [534962] | |||
| Bb-3497 | Drug Info | [551393] | |||
| Cysteinesulfonic Acid | Drug Info | [551393] | |||
| Double Oxidized Cysteine | Drug Info | [551393] | |||
| Formic Acid | Drug Info | [551393] | |||
| HYDROXY[3-(6-METHYLPYRIDIN-2-YL)PROPYL]FORMAMIDE | Drug Info | [551374] | |||
| N-(2-Acetamido)Iminodiacetic Acid | Drug Info | [551393] | |||
| N-alkyl urea hydroxamic acids | Drug Info | [535535] | |||
| NVP-PDF386 (VRC4887) | Drug Info | [535642] | |||
| VRC3375 | Drug Info | [535885] | |||
| [HYDROXY(3-PHENYLPROPYL)AMINO]METHANOL | Drug Info | [551374] | |||
| Modulator | GSK1322322 | Drug Info | [532261], [532938] | ||
| Binder | Hydroxamates | Drug Info | [536135] | ||
| References | |||||
| Ref 532261 | Comparative analysis of the antibacterial activity of a novel peptide deformylase inhibitor, GSK1322322. Antimicrob Agents Chemother. 2013 May;57(5):2333-42. | ||||
| Ref 532938 | Peptide deformylase: a new target in antibacterial, antimalarial and anticancer drug discovery. Curr Med Chem. 2015;22(2):214-36. | ||||
| Ref 534962 | Actinonin, a naturally occurring antibacterial agent, is a potent deformylase inhibitor. Biochemistry. 2000 Feb 15;39(6):1256-62. | ||||
| Ref 535535 | N-alkyl urea hydroxamic acids as a new class of peptide deformylase inhibitors with antibacterial activity. Antimicrob Agents Chemother. 2002 Sep;46(9):2752-64. | ||||
| Ref 535642 | Comparative spectrum and activity of NVP-PDF386 (VRC4887), a new peptide deformylase inhibitor. J Antimicrob Chemother. 2003 Jan;51(1):157-61. | ||||
| Ref 535885 | Peptide deformylase inhibitors as antibacterial agents: identification of VRC3375, a proline-3-alkylsuccinyl hydroxamate derivative, by using an integrated combinatorial and medicinal chemistry approach. Antimicrob Agents Chemother. 2004 Jan;48(1):250-61. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
