Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T78692
|
||||
| Former ID |
TTDS00150
|
||||
| Target Name |
ATP-sensitive K+ channel
|
||||
| Gene Name |
KCNJ5
|
||||
| Synonyms |
CIR; Cardiac inward rectifier; GIRK4; Heart KATP channel; Inward rectifier K+ channel Kir3.4; KATP channel; KATP-1; Potassium channel, inwardly rectifying, subfamily J, member 5; KCNJ5
|
||||
| Target Type |
Research
|
||||
| Function |
This potassium channel is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by external barium.
|
||||
| BioChemical Class |
Inward rectifier K(+) channel
|
||||
| Target Validation |
T78692
|
||||
| UniProt ID | |||||
| Sequence |
MAGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKC
NVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDH VGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNA FMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIK SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINQKSPFWEMSQAQLHQEEFE VVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTP SCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGGSREARGSV |
||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Circadian entrainment | ||||
| Retrograde endocannabinoid signaling | |||||
| Serotonergic synapse | |||||
| Dopaminergic synapse | |||||
| Estrogen signaling pathway | |||||
| Oxytocin signaling pathway | |||||
| Morphine addiction | |||||
| PANTHER Pathway | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | ||||
| Muscarinic acetylcholine receptor 2 and 4 signaling pathway | |||||
| PathWhiz Pathway | Muscle/Heart Contraction | ||||
| Reactome | Activation of G protein gated Potassium channels | ||||
| Inhibition of voltage gated Ca2+ channels via Gbeta/gamma subunits | |||||
| WikiPathways | Calcium Regulation in the Cardiac Cell | ||||
| Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell | |||||
| Notch Signaling Pathway | |||||
| Potassium Channels | |||||
| References | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
