Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T87670
|
||||
| Former ID |
TTDNR00683
|
||||
| Target Name |
G-protein coupled receptor 55
|
||||
| Gene Name |
GPR55
|
||||
| Synonyms |
GPR55
|
||||
| Target Type |
Research
|
||||
| Function |
May be involved in hyperalgesia associated with inflammatory and neuropathic pain (By similarity). Receptor for L- alpha-lysophosphatidylinositol (LPI). LPI induces Ca(2+) release from intracellular stores via the heterotrimeric G protein GNA13 and RHOA. Putative cannabinoid receptor. May play a role in bone physiology by regulating osteoclast number and function.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| UniProt ID | |||||
| Sequence |
MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATS
IYMINLAVFDLLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRF LAIRYPLLVSHLRSPRKIFGICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAK VFFPLEVFGFLLPMGIMGFCCSRSIHILLGRRDHTQDWVQQKACIYSIAASLAVFVVSFL PVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIR AHRPSRVQLVLQDTTISRG |
||||
| Agonist | 2-arachidonoylglycerolphosphoinositol | Drug Info | [529741] | ||
| 2-arachidonyl glyceryl ether | Drug Info | [529051] | |||
| abnormal cannabidiol | Drug Info | [529051] | |||
| CID1172084 | Drug Info | [531457] | |||
| CID1792197 | Drug Info | [531457] | |||
| CID2440433 | Drug Info | [531457] | |||
| CP55,244 | Drug Info | [531335] | |||
| GSK494581A | Drug Info | [531335] | |||
| GSK575594A | Drug Info | [531335] | |||
| lysophosphatidylinositol | Drug Info | [532227] | |||
| N-oleoylethanolamide | Drug Info | [529051] | |||
| N-palmitoylethanolamine | Drug Info | [529051] | |||
| O-1602 | Drug Info | [531264] | |||
| O-arachidonoyl ethanolamine | Drug Info | [529051] | |||
| T1117 | Drug Info | [530689] | |||
| [3H]CP55940 | Drug Info | [529051] | |||
| Antagonist | CID16020046 | Drug Info | [532339] | ||
| CP55,667 | Drug Info | [531335] | |||
| Pathways | |||||
| References | |||||
| Ref 529051 | The orphan receptor GPR55 is a novel cannabinoid receptor. Br J Pharmacol. 2007 Dec;152(7):1092-101. Epub 2007 Sep 17. | ||||
| Ref 529741 | 2-Arachidonoyl-sn-glycero-3-phosphoinositol: a possible natural ligand for GPR55. J Biochem. 2009 Jan;145(1):13-20. | ||||
| Ref 530689 | Fluorescent ligand binding reveals heterogeneous distribution of adrenoceptors and 'cannabinoid-like' receptors in small arteries. Br J Pharmacol. 2010 Feb;159(4):787-96. | ||||
| Ref 531264 | International Union of Basic and Clinical Pharmacology. LXXIX. Cannabinoid receptors and their ligands: beyond CB??and CB?? Pharmacol Rev. 2010 Dec;62(4):588-631. | ||||
| Ref 531335 | Pharmacology of GPR55 in yeast and identification of GSK494581A as a mixed-activity glycine transporter subtype 1 inhibitor and GPR55 agonist. J Pharmacol Exp Ther. 2011 Apr;337(1):236-46. | ||||
| Ref 531457 | Identification of the GPR55 agonist binding site using a novel set of high-potency GPR55 selective ligands. Biochemistry. 2011 Jun 28;50(25):5633-47. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
