Target General Infomation
Target ID
T87670
Former ID
TTDNR00683
Target Name
G-protein coupled receptor 55
Gene Name
GPR55
Synonyms
GPR55
Target Type
Research
Function
May be involved in hyperalgesia associated with inflammatory and neuropathic pain (By similarity). Receptor for L- alpha-lysophosphatidylinositol (LPI). LPI induces Ca(2+) release from intracellular stores via the heterotrimeric G protein GNA13 and RHOA. Putative cannabinoid receptor. May play a role in bone physiology by regulating osteoclast number and function.
BioChemical Class
GPCR rhodopsin
UniProt ID
Sequence
MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATS
IYMINLAVFDLLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRF
LAIRYPLLVSHLRSPRKIFGICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAK
VFFPLEVFGFLLPMGIMGFCCSRSIHILLGRRDHTQDWVQQKACIYSIAASLAVFVVSFL
PVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIR
AHRPSRVQLVLQDTTISRG
Agonist 2-arachidonoylglycerolphosphoinositol Drug Info [529741]
2-arachidonyl glyceryl ether Drug Info [529051]
abnormal cannabidiol Drug Info [529051]
CID1172084 Drug Info [531457]
CID1792197 Drug Info [531457]
CID2440433 Drug Info [531457]
CP55,244 Drug Info [531335]
GSK494581A Drug Info [531335]
GSK575594A Drug Info [531335]
lysophosphatidylinositol Drug Info [532227]
N-oleoylethanolamide Drug Info [529051]
N-palmitoylethanolamine Drug Info [529051]
O-1602 Drug Info [531264]
O-arachidonoyl ethanolamine Drug Info [529051]
T1117 Drug Info [530689]
[3H]CP55940 Drug Info [529051]
Antagonist CID16020046 Drug Info [532339]
CP55,667 Drug Info [531335]
Pathways
Reactome Class A/1 (Rhodopsin-like receptors)
G alpha (i) signalling events
WikiPathways GPCR ligand binding
GPCR downstream signaling
GPCRs, Other
References
Ref 529051The orphan receptor GPR55 is a novel cannabinoid receptor. Br J Pharmacol. 2007 Dec;152(7):1092-101. Epub 2007 Sep 17.
Ref 5297412-Arachidonoyl-sn-glycero-3-phosphoinositol: a possible natural ligand for GPR55. J Biochem. 2009 Jan;145(1):13-20.
Ref 530689Fluorescent ligand binding reveals heterogeneous distribution of adrenoceptors and 'cannabinoid-like' receptors in small arteries. Br J Pharmacol. 2010 Feb;159(4):787-96.
Ref 531264International Union of Basic and Clinical Pharmacology. LXXIX. Cannabinoid receptors and their ligands: beyond CB??and CB?? Pharmacol Rev. 2010 Dec;62(4):588-631.
Ref 531335Pharmacology of GPR55 in yeast and identification of GSK494581A as a mixed-activity glycine transporter subtype 1 inhibitor and GPR55 agonist. J Pharmacol Exp Ther. 2011 Apr;337(1):236-46.
Ref 531457Identification of the GPR55 agonist binding site using a novel set of high-potency GPR55 selective ligands. Biochemistry. 2011 Jun 28;50(25):5633-47.
Ref 532227Screening beta-arrestin recruitment for the identification of natural ligands for orphan G-protein-coupled receptors. J Biomol Screen. 2013 Jun;18(5):599-609.
Ref 532339A selective antagonist reveals a potential role of G protein-coupled receptor 55 in platelet and endothelial cell function. J Pharmacol Exp Ther. 2013 Jul;346(1):54-66.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.