Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T92609
|
||||
| Former ID |
TTDC00292
|
||||
| Target Name |
Alpha-1A adrenergic receptor
|
||||
| Gene Name |
ADRA1A
|
||||
| Synonyms |
Alpha 1A-adrenoceptor; Alpha 1A-adrenoreceptor; Alpha adrenergic receptor 1c; Alpha-1C adrenergic receptor; ADRA1A
|
||||
| Target Type |
Successful
|
||||
| Disease | Benign prostatic hyperplasia [ICD9: 600; ICD10: N40] | ||||
| Cognitive disorders [ICD9: 290-294, 294.0, 780.09, 780.9, 780.93; ICD10: F01-F07, F04, F05, R41.3] | |||||
| Female sexual dysfunction [ICD9: 302.7; ICD10: F52] | |||||
| Glaucoma [ICD9: 365; ICD10: H40-H42] | |||||
| Hypertension [ICD9: 401; ICD10: I10-I16] | |||||
| Heart arrhythmia [ICD10: I47-I49] | |||||
| Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32] | |||||
| Prostate hyperplasia [ICD10: N40] | |||||
| Prostate cancer; Benign prostatic hyperplasia [ICD9: 140-229, 185, 600; ICD10: C61, N40] | |||||
| Prostate disease [ICD10: N42.9] | |||||
| Post-traumatic stress disorder [ICD9: 309.81; ICD10: F43.1] | |||||
| Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
| Stress urinary incontinence [ICD10: N39.3] | |||||
| Urinary incontinence [ICD9: 788.3; ICD10: N39.3, N39.4, R32] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
This alpha-adrenergic receptor mediates its action by association with g proteins that activate a phosphatidylinositol- calcium second messenger system, and its effect is mediated by G(q) and G(11) proteins.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T92609
|
||||
| UniProt ID | |||||
| Sequence |
MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN APAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTL HPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | NAFTOPIDIL | Drug Info | Approved | Hypertension | [551871] |
| SILODOSIN | Drug Info | Approved | Benign prostatic hyperplasia | [468101], [529941], [530665] | |
| Tamsulosin | Drug Info | Approved | Benign prostatic hyperplasia | [468085], [536610] | |
| Xatral | Drug Info | Approved | Benign prostatic hyperplasia | [551871] | |
| Besipirdine | Drug Info | Phase 3 | Cognitive disorders | [550094] | |
| Dutasteride + tamsulosin | Drug Info | Phase 3 | Prostate cancer; Benign prostatic hyperplasia | [521609] | |
| MEDETOMIDINE | Drug Info | Phase 2 | Pain | [529347] | |
| CM-2236 | Drug Info | Preclinical | Post-traumatic stress disorder | [548834] | |
| Sunepitron | Drug Info | Discontinued in Phase 3 | Discovery agent | [545699] | |
| TIOSPIRONE | Drug Info | Discontinued in Phase 3 | Discovery agent | [538617], [544679] | |
| L-771688 | Drug Info | Discontinued in Phase 2 | Prostate disease | [547208] | |
| MAZAPERTINE | Drug Info | Discontinued in Phase 2 | Discovery agent | [545274] | |
| RBx-2258 | Drug Info | Discontinued in Phase 2 | Prostate hyperplasia | [547000] | |
| SOU-001 | Drug Info | Discontinued in Phase 2 | Urinary incontinence | [547251] | |
| Taprizosin | Drug Info | Discontinued in Phase 2 | Prostate hyperplasia | [547527] | |
| UPIDOSIN | Drug Info | Discontinued in Phase 2 | Discovery agent | [468110], [545508] | |
| RS-100975 | Drug Info | Discontinued in Phase 1 | Prostate disease | [468114], [547119] | |
| SDZ-NVI-085 | Drug Info | Discontinued in Phase 1 | Major depressive disorder | [544963] | |
| A-131701 | Drug Info | Terminated | Discovery agent | [546501] | |
| A-204176 | Drug Info | Terminated | Stress urinary incontinence | [547179] | |
| ABANOQUIL | Drug Info | Terminated | Discovery agent | [544556] | |
| AGN-193080 | Drug Info | Terminated | Discovery agent | [546437] | |
| BMY-7378 | Drug Info | Terminated | Discovery agent | [543289], [544847] | |
| KRG-3332 | Drug Info | Terminated | Glaucoma | [547722] | |
| L-757464 | Drug Info | Terminated | Prostate hyperplasia | [546739] | |
| NIGULDIPINE | Drug Info | Terminated | Discovery agent | [468083], [545183] | |
| Siramesine | Drug Info | Terminated | Discovery agent | [545008] | |
| SK&F-104078 | Drug Info | Terminated | Discovery agent | [544626] | |
| SK&F-104856 | Drug Info | Terminated | Discovery agent | [544924] | |
| SNAP-5089 | Drug Info | Terminated | Heart arrhythmia | [468115], [546179] | |
| SNAP-6201 | Drug Info | Terminated | Discovery agent | [546603] | |
| WB-4101 | Drug Info | Terminated | Discovery agent | [468117], [545656] | |
| Sunepitron | Drug Info | Investigative | Unspecified | [528210] | |
| Inhibitor | (+/-)-nantenine | Drug Info | [530558] | ||
| (-)-SNAP-5399 | Drug Info | [527393] | |||
| (2,6-Dichloro-phenyl)-(1H-imidazol-2-yl)-amine | Drug Info | [534315] | |||
| (2-Bromo-phenyl)-(1H-imidazol-2-yl)-amine | Drug Info | [534315] | |||
| 1',2',3',6'-Tetrahydro-[2,4']bipyridinyl | Drug Info | [533509] | |||
| 1-(2-Chloro-phenyl)-piperazine | Drug Info | [528039] | |||
| 1-(2-Methoxy-phenyl)-piperazine | Drug Info | [528039] | |||
| 1-(3-Fluoro-pyridin-2-yl)-4-methyl-piperazine | Drug Info | [533509] | |||
| 1-(pyridin-2-yl)piperazine | Drug Info | [533509] | |||
| 2-(4-tert-Butyl-phenyl)-4,5-dihydro-1H-imidazole | Drug Info | [527180] | |||
| 2-Pyridin-4-yl-1,2,3,4-tetrahydro-isoquinoline | Drug Info | [526618] | |||
| 4-((E)-1-Naphthalen-1-yl-propenyl)-1H-imidazole | Drug Info | [534160] | |||
| 4-((Z)-1-Naphthalen-1-yl-propenyl)-1H-imidazole | Drug Info | [534160] | |||
| 4-(1-Naphthalen-1-yl-ethyl)-1H-imidazole | Drug Info | [533805] | |||
| 4-(1-Naphthalen-1-yl-propyl)-1H-imidazole | Drug Info | [534160] | |||
| 4-(1-Naphthalen-1-yl-vinyl)-1H-imidazole | Drug Info | [534160] | |||
| 4-(2,3-Dihydro-1H-phenalen-1-yl)-1H-imidazole | Drug Info | [534160] | |||
| 4-(3,4-Dihydro-1H-isoquinolin-2-yl)-quinoline | Drug Info | [526618] | |||
| 4-(3-Hydroxy-piperidin-3-yl)-benzene-1,2-diol | Drug Info | [526729] | |||
| 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [531079] | |||
| 4-(4-chlorobenzyl)-2-allylphthalazin-1(2H)-one | Drug Info | [528062] | |||
| 4-(4-chlorobenzyl)-2-methylphthalazin-1(2H)-one | Drug Info | [528062] | |||
| 4-(4-chlorobenzyl)phthalazin-1(2H)-one | Drug Info | [528062] | |||
| 4-(4-Isopropyl-morpholin-2-yl)-benzene-1,2-diol | Drug Info | [526729] | |||
| 4-(4-Methyl-indan-1-yl)-1H-imidazole | Drug Info | [534467] | |||
| 4-Benzo[b]thiophen-4-yl-1H-imidazole | Drug Info | [525720] | |||
| 4-benzyl-2-methylphthalazin-1(2H)-one | Drug Info | [528062] | |||
| 4-Morpholin-2-yl-benzene-1,2-diol | Drug Info | [526729] | |||
| 5-Bromo-8-piperazin-1-yl-imidazo[1,2-a]pyrazine | Drug Info | [526778] | |||
| 8-Piperazin-1-yl-imidazo[1,2-a]pyrazine | Drug Info | [526778] | |||
| A-119637 | Drug Info | [527393] | |||
| A-123189 | Drug Info | [527393] | |||
| A-131701 | Drug Info | [527393] | |||
| A-315456 | Drug Info | [527393] | |||
| ABANOQUIL | Drug Info | [533682] | |||
| AGN-192172 | Drug Info | [551280] | |||
| AGN-193080 | Drug Info | [551280] | |||
| BMY-7378 | Drug Info | [527512] | |||
| CORYNANTHEINE | Drug Info | [527393] | |||
| FLUANISONE | Drug Info | [533378] | |||
| Imidazolidin-2-ylidene-o-tolyl-amine | Drug Info | [551280] | |||
| Imidazolidin-2-ylidene-quinoxalin-6-yl-amine | Drug Info | [551280] | |||
| ISOCLOZAPINE | Drug Info | [534532] | |||
| L-765314 | Drug Info | [527393] | |||
| L-771688 | Drug Info | [527393] | |||
| LEVONORDEFRIN | Drug Info | [534160] | |||
| MAZAPERTINE | Drug Info | [533800] | |||
| MEDETOMIDINE | Drug Info | [533805] | |||
| N-(5-Bromo-quinoxalin-6-yl)-guanidine | Drug Info | [551280] | |||
| NAFTOPIDIL | Drug Info | [527393] | |||
| NIGULDIPINE | Drug Info | [533638] | |||
| OCTOCLOTHEPIN | Drug Info | [531171] | |||
| R-226161 | Drug Info | [528772] | |||
| Ro-11-04253 | Drug Info | [527393] | |||
| RS-100329 | Drug Info | [527393] | |||
| RS-513815 | Drug Info | [527393] | |||
| RWJ-38063 | Drug Info | [527393] | |||
| RWJ-68141 | Drug Info | [527393] | |||
| RWJ-68157 | Drug Info | [527393] | |||
| RWJ-69736 | Drug Info | [527393] | |||
| RX-821002 | Drug Info | [533375] | |||
| SILODOSIN | Drug Info | [527393] | |||
| Siramesine | Drug Info | [533739] | |||
| SK&F-104078 | Drug Info | [533638] | |||
| SK&F-104856 | Drug Info | [533638] | |||
| SK&F-105854 | Drug Info | [527393] | |||
| SK&F-106686 | Drug Info | [533638] | |||
| SK&F-86466 | Drug Info | [533638] | |||
| SNAP-5036 | Drug Info | [527393] | |||
| SNAP-5089 | Drug Info | [533638] | |||
| SNAP-6201 | Drug Info | [527393] | |||
| SNAP-7915 | Drug Info | [527393] | |||
| SNAP-8719 | Drug Info | [527512] | |||
| SNAP-94847 | Drug Info | [528972] | |||
| SPIPERONE | Drug Info | [527393] | |||
| Sunepitron | Drug Info | [528210] | |||
| TIOSPIRONE | Drug Info | [534093] | |||
| UH-301 | Drug Info | [534363] | |||
| UPIDOSIN | Drug Info | [527393] | |||
| WB-4101 | Drug Info | [533682] | |||
| Agonist | 4-Methoxyamphetamine | Drug Info | [551380] | ||
| A-204176 | Drug Info | [526245] | |||
| CM-2236 | Drug Info | [550867] | |||
| Antagonist | Besipirdine | Drug Info | [534361] | ||
| Dutasteride + tamsulosin | Drug Info | [550963] | |||
| GG-818 | Drug Info | [534666] | |||
| KRG-3332 | Drug Info | [534750] | |||
| L-757464 | Drug Info | [546740] | |||
| RBx-2258 | Drug Info | [544170] | |||
| REC2615 | Drug Info | [536493] | |||
| RS-100975 | Drug Info | [525514] | |||
| SDZ-NVI-085 | Drug Info | [534234] | |||
| Taprizosin | Drug Info | [528839] | |||
| Xatral | Drug Info | [549823] | |||
| Modulator | SOU-001 | Drug Info | [527154] | ||
| Tamsulosin | Drug Info | [556264] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Calcium signaling pathway | ||||
| cGMP-PKG signaling pathway | |||||
| Neuroactive ligand-receptor interaction | |||||
| AMPK signaling pathway | |||||
| Adrenergic signaling in cardiomyocytes | |||||
| Vascular smooth muscle contraction | |||||
| Salivary secretion | |||||
| PANTHER Pathway | Alpha adrenergic receptor signaling pathway | ||||
| Reactome | Adrenoceptors | ||||
| G alpha (q) signalling events | |||||
| G alpha (12/13) signalling events | |||||
| WikiPathways | Monoamine GPCRs | ||||
| Calcium Regulation in the Cardiac Cell | |||||
| GPCRs, Class A Rhodopsin-like | |||||
| Gastrin-CREB signalling pathway via PKC and MAPK | |||||
| Endothelin Pathways | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| AMPK Signaling | |||||
| References | |||||
| Ref 468083 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 487). | ||||
| Ref 468085 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 488). | ||||
| Ref 468101 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 493). | ||||
| Ref 468110 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 496). | ||||
| Ref 468114 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 497). | ||||
| Ref 468115 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 498). | ||||
| Ref 468117 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 499). | ||||
| Ref 521609 | ClinicalTrials.gov (NCT00090103) Benign Prostatic Hyperplasia Trial With Dutasteride And Tamsulosin Combination Treatment. U.S. National Institutes of Health. | ||||
| Ref 528210 | J Med Chem. 2006 Jun 1;49(11):3116-35.An integrated in silico 3D model-driven discovery of a novel, potent, and selective amidosulfonamide 5-HT1A agonist (PRX-00023) for the treatment of anxiety and depression. | ||||
| Ref 529347 | Sedative and cardiopulmonary effects of medetomidine hydrochloride and xylazine hydrochloride and their reversal with atipamezole hydrochloride in calves. Am J Vet Res. 2008 Mar;69(3):319-29. | ||||
| Ref 530665 | Silodosin: a selective alpha1A-adrenergic receptor antagonist for the treatment of benign prostatic hyperplasia. Clin Ther. 2009 Nov;31(11):2489-502. | ||||
| Ref 536610 | Alpha blockers for the treatment of benign prostatic hyperplasia. Rev Urol. 2007 Fall;9(4):181-90. | ||||
| Ref 538617 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 101). | ||||
| Ref 543289 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 9). | ||||
| Ref 544556 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000128) | ||||
| Ref 544626 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000354) | ||||
| Ref 544679 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000562) | ||||
| Ref 544847 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001317) | ||||
| Ref 544924 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001560) | ||||
| Ref 544963 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001726) | ||||
| Ref 545008 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001859) | ||||
| Ref 545183 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002398) | ||||
| Ref 545274 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002662) | ||||
| Ref 545508 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003537) | ||||
| Ref 545656 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004048) | ||||
| Ref 545699 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004255) | ||||
| Ref 546179 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006771) | ||||
| Ref 546437 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008130) | ||||
| Ref 546501 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008617) | ||||
| Ref 546603 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009143) | ||||
| Ref 546739 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010051) | ||||
| Ref 547000 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011920) | ||||
| Ref 547119 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013213) | ||||
| Ref 547179 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013646) | ||||
| Ref 547208 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014018) | ||||
| Ref 547251 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014478) | ||||
| Ref 547527 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017098) | ||||
| Ref 547722 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018805) | ||||
| Ref 525514 | In vitro alpha1-adrenoceptor pharmacology of Ro 70-0004 and RS-100329, novel alpha1A-adrenoceptor selective antagonists. Br J Pharmacol. 1999 May;127(1):252-8. | ||||
| Ref 525720 | J Med Chem. 2000 Mar 9;43(5):765-8.alpha(2) Adrenoceptor agonists as potential analgesic agents. 2. Discovery of 4-(4-Imidazo)-1,3-dimethyl-6,7-dihydrothianaphthene [corrected] as a high-affinity ligand for the alpha(2D) adrenergic receptor. | ||||
| Ref 526245 | Pharmacological properties of A-204176, a novel and selective alpha1A adrenergic agonist, in in vitro and in vivo models of urethral function. Life Sci. 2001 Nov 30;70(2):181-97. | ||||
| Ref 526618 | Bioorg Med Chem Lett. 2003 May 19;13(10):1759-62.4-(3,4-dihydro-1H-isoquinolin-2yl)-pyridines and 4-(3,4-dihydro-1H-isoquinolin-2-yl)-quinolines as potent NR1/2B subtype selective NMDA receptor antagonists. | ||||
| Ref 526729 | J Med Chem. 1992 Mar 20;35(6):1009-18.Conformational effects on the activity of drugs. 13. A revision of previously proposed models for the activation of alpha- and beta-adrenergic receptors. | ||||
| Ref 526778 | J Med Chem. 1992 Oct 16;35(21):3845-57.Synthesis and hypoglycemic activity of substituted 8-(1-piperazinyl)imidazo[1,2-a]pyrazines. | ||||
| Ref 527154 | Drug repositioning: identifying and developing new uses for existing drugs. Nat Rev Drug Discov. 2004 Aug;3(8):673-83. | ||||
| Ref 527180 | Bioorg Med Chem Lett. 2004 Sep 20;14(18):4697-9.2-(Anilino)imidazolines and 2-(benzyl)imidazoline derivatives as h5-HT1D serotonin receptor ligands. | ||||
| Ref 527393 | Bioorg Med Chem Lett. 2005 Feb 1;15(3):657-64.Pharmacophore identification of alpha(1A)-adrenoceptor antagonists. | ||||
| Ref 527512 | J Med Chem. 2005 Apr 21;48(8):3076-9.Synthesis and structure-activity relationship of fluoro analogues of 8-{2-[4-(4-methoxyphenyl)piperazin-1yl]ethyl}-8-azaspiro[4.5]decane-7,9-dione as selective alpha(1d)-adrenergic receptor antagonists. | ||||
| Ref 528039 | J Med Chem. 1991 Jun;34(6):1850-4.Pyrimido[5,4-b]indole derivatives. 1. A new class of potent and selective alpha 1 adrenoceptor ligands. | ||||
| Ref 528062 | Bioorg Med Chem Lett. 2006 May 15;16(10):2786-90. Epub 2006 Mar 2.Vasorelaxant activity of phthalazinones and related compounds. | ||||
| Ref 528210 | J Med Chem. 2006 Jun 1;49(11):3116-35.An integrated in silico 3D model-driven discovery of a novel, potent, and selective amidosulfonamide 5-HT1A agonist (PRX-00023) for the treatment of anxiety and depression. | ||||
| Ref 528772 | Bioorg Med Chem. 2007 Jun 1;15(11):3649-60. Epub 2007 Mar 21.Tricyclic isoxazolines: identification of R226161 as a potential new antidepressant that combines potent serotonin reuptake inhibition and alpha2-adrenoceptor antagonism. | ||||
| Ref 528839 | Impact of physicochemical and structural properties on the pharmacokinetics of a series of alpha1L-adrenoceptor antagonists. Drug Metab Dispos. 2007 Aug;35(8):1435-45. Epub 2007 May 14. | ||||
| Ref 528972 | J Med Chem. 2007 Aug 9;50(16):3883-90.Synthesis and SAR investigations for novel melanin-concentrating hormone 1 receptor (MCH1) antagonists part 2: A hybrid strategy combining key fragments of HTS hits. | ||||
| Ref 530558 | Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. Epub 2009 Nov 20.Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. | ||||
| Ref 531079 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
| Ref 531171 | J Med Chem. 2010 Oct 14;53(19):7021-34.Exploring the neuroleptic substituent in octoclothepin: potential ligands for positron emission tomography with subnanomolar affinity for |A(1)-adrenoceptors. | ||||
| Ref 533375 | J Med Chem. 1986 Oct;29(10):2000-3.Alpha-adrenoreceptor reagents. 4. Resolution of some potent selective prejunctional alpha 2-adrenoreceptor antagonists. | ||||
| Ref 533378 | J Med Chem. 1987 Nov;30(11):2099-104.2-Phenylpyrroles as conformationally restricted benzamide analogues. A new class of potential antipsychotics. 1. | ||||
| Ref 533509 | J Med Chem. 1984 Sep;27(9):1182-5.Adrenoceptor and tetrabenazine antagonism activities of some pyridinyltetrahydropyridines. | ||||
| Ref 533638 | J Med Chem. 1995 Sep 15;38(19):3681-716.Alpha- and beta-adrenoceptors: from the gene to the clinic. 2. Structure-activity relationships and therapeutic applications. | ||||
| Ref 533682 | J Med Chem. 1995 Sep 1;38(18):3415-44.Alpha- and beta-adrenoceptors: from the gene to the clinic. 1. Molecular biology and adrenoceptor subclassification. | ||||
| Ref 533739 | J Med Chem. 1995 May 26;38(11):1998-2008.Sigma ligands with subnanomolar affinity and preference for the sigma 2 binding site. 1. 3-(omega-aminoalkyl)-1H-indoles. | ||||
| Ref 533800 | J Med Chem. 1994 Apr 15;37(8):1060-2.A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. | ||||
| Ref 533805 | J Med Chem. 1994 Jul 22;37(15):2328-33.A structure-activity relationship study of benzylic modifications of 4-[1-(1-naphthyl)ethyl]-1H-imidazoles on alpha 1- and alpha 2-adrenergic receptors. | ||||
| Ref 534093 | J Med Chem. 1996 Jan 5;39(1):143-8.3-Benzisothiazolylpiperazine derivatives as potential atypical antipsychotic agents. | ||||
| Ref 534160 | J Med Chem. 1996 Jul 19;39(15):3001-13.Medetomidine analogs as alpha 2-adrenergic ligands. 2. Design, synthesis, and biological activity of conformationally restricted naphthalene derivatives of medetomidine. | ||||
| Ref 534234 | SDZ NVI 085, an alpha 1A-adrenoceptor agonist with 5-HT2A receptor antagonist properties. Eur J Pharmacol. 1996 Feb 15;297(1-2):83-6. | ||||
| Ref 534315 | J Med Chem. 1997 Jan 3;40(1):18-23.Synthesis and evaluation of 2-(arylamino)imidazoles as alpha 2-adrenergic agonists. | ||||
| Ref 534361 | Alpha-Adrenergic activity and cardiovascular effects of besipirdine HCl (HP 749) and metabolite P7480 in vitro and in the conscious rat and dog. J Pharmacol Exp Ther. 1997 Apr;281(1):337-46. | ||||
| Ref 534363 | J Med Chem. 1997 Apr 11;40(8):1252-7.N-[2-[(substituted chroman-8-yl)oxy]ethyl]-4-(4-methoxyphenyl)butylamines: synthesis and wide range of antagonism at the human 5-HT1A receptor. | ||||
| Ref 534467 | J Med Chem. 1997 Sep 12;40(19):3014-24.Medetomidine analogs as alpha 2-adrenergic ligands. 3. Synthesis and biological evaluation of a new series of medetomidine analogs and their potential binding interactions with alpha 2-adrenoceptors involving a "methyl pocket". | ||||
| Ref 534532 | J Med Chem. 1997 Dec 5;40(25):4146-53.Synthesis and pharmacological evaluation of triflate-substituted analogues of clozapine: identification of a novel atypical neuroleptic. | ||||
| Ref 534666 | In situ salt screening--a useful technique for discovery support and preformulation studies. Pharm Dev Technol. 1998 May;3(2):215-23. | ||||
| Ref 536493 | Designing drugs for the treatment of female sexual dysfunction. Drug Discov Today. 2007 Sep;12(17-18):757-66. Epub 2007 Aug 27. | ||||
| Ref 544170 | Drug Metabolism and Pharmacokinetics. Indian J Pharmacol. 2008 October; 40(Suppl 2): S91-S97. | ||||
| Ref 546740 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010051) | ||||
| Ref 550867 | CN patent application no. 104151292, Indole derivative or a pharmaceutically acceptable salt thereof. | ||||
| Ref 551280 | Analogs of UK 14,304: Structural features responsible for alpha2 adrenoceptor activity, Bioorg. Med. Chem. Lett. 5(15):1745-1750 (1995). | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
