Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T93788
|
||||
| Former ID |
TTDC00050
|
||||
| Target Name |
Glucose-dependent insulinotropic receptor
|
||||
| Gene Name |
GPR119
|
||||
| Synonyms |
G-protein coupled receptor 119; GPR119
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Diabetes [ICD9: 253.5, 588.1; ICD10: E23.2, N25.1] | ||||
| Gastric cancer; Type 2 diabetes [ICD9:151, 250; ICD10: C16, E11] | |||||
| Non-insulin dependent diabetes [ICD10: E11.9] | |||||
| Peripheral arterial disease; Type 2 diabetes [ICD9:443, 250; ICD10: I73, E11] | |||||
| Type 2 diabetes [ICD9: 250; ICD10: E11] | |||||
| Function |
Receptor for the endogenous fatty-acid ethanolamide oleoylethanolamide (OEA) and lysophosphatidylcholine (LPC). Functions as a glucose-dependent insulinotropic receptor. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Seems to act through a G(s) mediated pathway.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T93788
|
||||
| UniProt ID | |||||
| Sequence |
MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISG
LLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGF VAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLL FVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTP FLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKV LTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | DS-8500 | Drug Info | Phase 2 | Diabetes | [524885] |
| GSK1292263 | Drug Info | Phase 2 | Gastric cancer; Type 2 diabetes | [523205] | |
| SAR-260093 | Drug Info | Phase 2 | Type 2 diabetes | [548721] | |
| LEZ763 | Drug Info | Phase 1/2 | Peripheral arterial disease; Type 2 diabetes | [523944] | |
| APD-597 | Drug Info | Phase 1 | Type 2 diabetes | [522679], [541062] | |
| BMS-903452 | Drug Info | Phase 1 | Type 2 diabetes | [523251] | |
| APD668 | Drug Info | Discontinued in Phase 1 | Type 2 diabetes | [548256] | |
| PSN821 | Drug Info | Terminated | Type 2 diabetes | [550284] | |
| Agonist | (R)-N-oleoyltyrosinol | Drug Info | [530508] | ||
| (S)-N-oleoyltyrosinol | Drug Info | [530508] | |||
| 1-oleoyl glycerol | Drug Info | [531569] | |||
| 1-palmitoyl-lysophosphatidylcholine | Drug Info | [527346] | |||
| 1-stearoyl-lysophosphatidylcholine | Drug Info | [527346] | |||
| 2-oleoyl glycerol | Drug Info | [531569] | |||
| APD-597 | Drug Info | [531766] | |||
| APD668 | Drug Info | [551535] | |||
| AR231453 | Drug Info | [528663] | |||
| AS-1907417 | Drug Info | [543393] | |||
| AS1269574 | Drug Info | [531137] | |||
| compound 1 | Drug Info | [531346] | |||
| compound 1 | Drug Info | [531631] | |||
| compound 2 | Drug Info | [531631] | |||
| compound 20f | Drug Info | [531459] | |||
| compound 23 | Drug Info | [531413] | |||
| compound 29a | Drug Info | [531413] | |||
| compound 3 | Drug Info | [531359] | |||
| compound 36 | Drug Info | [531346] | |||
| compound 36j | Drug Info | [531459] | |||
| compound 3a | Drug Info | [531413] | |||
| compound 3j | Drug Info | [531413] | |||
| compound 42 | Drug Info | [531890] | |||
| compound 58 | Drug Info | [531346] | |||
| compound 8g | Drug Info | [531413] | |||
| GPR119 agonists | Drug Info | [543393] | |||
| LC34AD3 | Drug Info | [543393] | |||
| lysophosphatidylethanolamine | Drug Info | [527346] | |||
| lysophosphatidylinositol | Drug Info | [527346] | |||
| N-oleoylethanolamide | Drug Info | [532227] | |||
| N-palmitoylethanolamine | Drug Info | [543393] | |||
| oleoyl-lysophosphatidylcholine | Drug Info | [527346] | |||
| PSN375963 | Drug Info | [528067] | |||
| PSN632408 | Drug Info | [528067] | |||
| PSN821 | Drug Info | [550284] | |||
| RO-5212651 | Drug Info | [543393] | |||
| SAR-260093 | Drug Info | [530406] | |||
| SEA | Drug Info | [543393] | |||
| Modulator | AR-7947 | Drug Info | [543393] | ||
| BMS-903452 | Drug Info | [532950] | |||
| DS-8500 | Drug Info | [544477] | |||
| GSK1292263 | Drug Info | ||||
| LEZ763 | Drug Info | ||||
| MBX-3254 | Drug Info | [543393] | |||
| Pathways | |||||
| KEGG Pathway | cAMP signaling pathway | ||||
| Insulin secretion | |||||
| WikiPathways | Incretin Synthesis, Secretion, and Inactivation | ||||
| References | |||||
| Ref 522679 | ClinicalTrials.gov (NCT00910923) A Study to Evaluate the Safety, Tolerability, Pharmacokinetics, and Pharmacodynamics of JNJ-38431055 in Healthy Male Volunteers. U.S. National Institutes of Health. | ||||
| Ref 523205 | ClinicalTrials.gov (NCT01218204) A Study to Investigate the Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of Administering Multiple Oral Doses of GSK1292263 Alone and With Atorvastatin.U.S. National Institutes of Health. | ||||
| Ref 523251 | ClinicalTrials.gov (NCT01240980) Safety Study of BMS-903452 in Healthy Subjects (Panel 1-7) & Relative Bioavailability of the Crystalline and Amorphous Forms of BMS-903452 [Panels 4, 6, 11 & 12(Part A)], and Subjects With Type 2 Diabetes Mellitus (Part B). U.S. National Institutes of Health. | ||||
| Ref 523944 | ClinicalTrials.gov (NCT01619332) Clinical Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of LEZ763. U.S. National Institutes of Health. | ||||
| Ref 524885 | ClinicalTrials.gov (NCT02222350) Phase 2 Study of DS-8500a in Patients With Type 2 Diabetes. U.S. National Institutes of Health. | ||||
| Ref 541062 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5727). | ||||
| Ref 548256 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023882) | ||||
| Ref 527346 | Lysophosphatidylcholine enhances glucose-dependent insulin secretion via an orphan G-protein-coupled receptor. Biochem Biophys Res Commun. 2005 Jan 28;326(4):744-51. | ||||
| Ref 528067 | Deorphanization of a G protein-coupled receptor for oleoylethanolamide and its use in the discovery of small-molecule hypophagic agents. Cell Metab. 2006 Mar;3(3):167-75. | ||||
| Ref 528663 | A role for beta-cell-expressed G protein-coupled receptor 119 in glycemic control by enhancing glucose-dependent insulin release. Endocrinology. 2007 Jun;148(6):2601-9. Epub 2007 Feb 8. | ||||
| Ref 530406 | GPR119 agonists for the treatment of type 2 diabetes. Expert Opin Ther Pat. 2009 Oct;19(10):1339-59. | ||||
| Ref 530508 | N-oleoyldopamine enhances glucose homeostasis through the activation of GPR119. Mol Endocrinol. 2010 Jan;24(1):161-70. | ||||
| Ref 531137 | Identification of a novel GPR119 agonist, AS1269574, with in vitro and in vivo glucose-stimulated insulin secretion. Biochem Biophys Res Commun. 2010 Sep 24;400(3):437-41. | ||||
| Ref 531346 | Design of potent and selective GPR119 agonists for type II diabetes. Bioorg Med Chem Lett. 2011 May 1;21(9):2665-9. | ||||
| Ref 531359 | Design and evaluation of a 2-(2,3,6-trifluorophenyl)acetamide derivative as an agonist of the GPR119 receptor. Bioorg Med Chem Lett. 2011 Mar 1;21(5):1306-9. | ||||
| Ref 531413 | Bioorg Med Chem Lett. 2011 May 15;21(10):3134-41. Epub 2011 Mar 13.Discovery of fused bicyclic agonists of the orphan G-protein coupled receptor GPR119 with in vivo activity in rodent models of glucose control. | ||||
| Ref 531459 | Discovery of a nortropanol derivative as a potent and orally active GPR119 agonist for type 2 diabetes. Bioorg Med Chem Lett. 2011 Jun 1;21(11):3290-6. | ||||
| Ref 531569 | 2-Oleoyl glycerol is a GPR119 agonist and signals GLP-1 release in humans. J Clin Endocrinol Metab. 2011 Sep;96(9):E1409-17. | ||||
| Ref 531631 | Oxidative metabolism of a quinoxaline derivative by xanthine oxidase in rodent plasma. Chem Res Toxicol. 2011 Dec 19;24(12):2207-16. | ||||
| Ref 531766 | Discovery of a second generation agonist of the orphan G-protein coupled receptor GPR119 with an improved profile. Bioorg Med Chem Lett. 2012 Feb 15;22(4):1750-5. | ||||
| Ref 531890 | Use of small-molecule crystal structures to address solubility in a novel series of G protein coupled receptor 119 agonists: optimization of a lead and in vivo evaluation. J Med Chem. 2012 Jun 14;55(11):5361-79. | ||||
| Ref 532227 | Screening beta-arrestin recruitment for the identification of natural ligands for orphan G-protein-coupled receptors. J Biomol Screen. 2013 Jun;18(5):599-609. | ||||
| Ref 532950 | Discovery of 5-chloro-4-((1-(5-chloropyrimidin-2-yl)piperidin-4-yl)oxy)-1-(2-fluoro-4-(methylsulfonyl)phenyl)pyridin-2(1H)-one (BMS-903452), an antidiabetic clinical candidate targeting GPR119. J MedChem. 2014 Sep 25;57(18):7499-508. | ||||
| Ref 543393 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 126). | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
