Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET00ASJ) | |||||
|---|---|---|---|---|---|
| Name |
Heat shock factor 1 (HSF1)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Heat shock transcription factor 1; HSF 1; HSTF 1
|
||||
| Family | Other protein families (OPF) >> Heat shock protein (HSP) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | HSF1 | Gene ID | |||
| UniProt ID | HSF1_HUMAN | (click to find more protein-related data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MDLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKY
FKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT SVSTLKSEDIKIRQDSVTKLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHA QQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLNDSGSAHSMPKYSRQFSLEHVHGSGPY SAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEE PPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGR PPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSP SVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGS VDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS |
||||
| Function |
Functions as a stress-inducible and DNA-binding transcription factor that plays a central role in the transcriptional activation of the heat shock response (HSR), leading to the expression of a large class of molecular chaperones heat shock proteins (HSPs) that protect cells from cellular insults' damage. In unstressed cells, is present in a HSP90-containing multichaperone complex that maintains it in a non-DNA-binding inactivated monomeric form.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: D&C red no. 30 | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
 click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 = 9054 nM (estimated based on the structural similarity with CHEMBL1339303 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 0.776859504 | |||||
| Tested Species | Mus musculus (Mouse) | |||||
| UniProt ID | HSF1_MOUSE | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | PubChem BioAssay data set. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.