Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET00WUF) | |||||
|---|---|---|---|---|---|
| Name |
Phospholipase A2 (PLA2)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Group IB phospholipase A2; Phosphatidylcholine 2-acylhydrolase 1B; PLA2; PLA2A; PPLA2; PLA2G1B
|
||||
| Family | Hydrolase (HDase) >> Ester bond hydrolase (EC 3.1) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | PLA2G1B | Gene ID | |||
| UniProt ID | PA21B_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T31479 | (click to find more therapeutic target data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPV
DELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNC DRNAAICFSKAPYNKAHKNLDTKKYCQS |
||||
| Function |
Secretory calcium-dependent phospholipase A2 that primarily targets dietary phospholipids in the intestinal tract. Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids (phospholipase A2 activity) with preference for phosphatidylethanolamines and phosphatidylglycerols over phosphatidylcholines. May play a role in the biosynthesis of N-acyl ethanolamines that regulate energy metabolism and inflammation in the intestinal tract.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Miripirium chloride | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
 click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 > 250000 nM (estimated based on the structural similarity with CHEMBL593699 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 1 | |||||
| Tested Species | Sus scrofa (Pig) | |||||
| UniProt ID | PA21B_PIG | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Synthesis, antifungal, haemolytic and cytotoxic activities of a series of bis(alkylpyridinium)alkanes. Bioorg Med Chem. 2009 Sep 1; 17(17):6329-39. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.