Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET01BTO) | |||||
---|---|---|---|---|---|
Name |
Muscarinic receptor M3 (ACM3)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Muscarinic acetylcholine receptor M3; Cholinergic receptor, muscarinic 3; M3R; M3 receptor; CHRM3; Chrm3; Cholinergic/acetylcholine receptor M3
|
||||
Family | G-protein coupled receptor (GPCR) >> G-protein coupled rhodopsin receptor (GPCR-A) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | CHRM3 | Gene ID | |||
UniProt ID | ACM3_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T67684 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL
GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL |
||||
Function |
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Methylpyrrolidone | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Penetration agent; Solubilizing agent; Solvent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | EC50 = 1800 nM (estimated based on the structural similarity with CHEMBL23957 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 0.87804878 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | ACM3_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | FRET-based sensors for the human M1-, M3-, and M5-acetylcholine receptors. Bioorg Med Chem. 2011 Feb 1; 19(3):1048-54. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.