Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET01XLJ)
Name
Inhibitor of apoptosis protein 3 (XIAP)
Synonyms    Click to Show/Hide the Synonyms of This DBT
X-linked inhibitor of apoptosis protein; API3; BIRC4; Baculoviral IAP repeat-containing protein 4; Baculoviral IAP repeatcontaining protein 4; E3 ubiquitin-protein ligase XIAP; E3 ubiquitinprotein ligase XIAP; IAP-3; IAP-like protein; IAP3; IAPlike protein; ILP; Inhibitor of apoptosis protein 3; RING-type E3 ubiquitin transferase XIAP; X-linked IAP; Xlinked IAP; hIAP-3; hIAP3; hILP
Family Transferase (TFase)  >>  Acyltransferase (EC 2.3)
Organism
Homo sapiens (Human)
Gene Name XIAP Gene ID
331
UniProt ID XIAP_HUMAN (click to find more protein-related data of this DBT)
TTD ID T16769 (click to find more therapeutic target data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENY
LGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSE
SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTP
SLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKD
SMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDK
CPMCYTVITFKQKIFMS
Function
Acts as a direct caspase inhibitor. Directly bind to the active site pocket of CASP3 and CASP7 and obstructs substrate entry. Inactivates CASP9 by keeping it in a monomeric, inactive state. Acts as an E3 ubiquitin-protein ligase regulating NF-kappa-B signaling and the target proteins for its E3 ubiquitin-protein ligase activity include: RIPK1, CASP3, CASP7, CASP8, CASP9, MAP3K2/MEKK2, DIABLO/SMAC, AIFM1, CCS and BIRC5/survivin. Ubiquitinion of CCS leads to enhancement of its chaperone activity toward its physiologic target, SOD1.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Phenylalanine Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Solubilizing agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 80200 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID XIAP_HUMAN
References
1 Exploration of carboxy pyrazole derivatives: Synthesis, alkaline phosphatase, nucleotide pyrophosphatase/phosphodiesterase and nucleoside triphosphate diphosphohydrolase inhibition studies with potential anticancer profile. Eur J Med Chem. 2018 Aug 5; 156:461-478.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.