Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET01ZWI) | |||||
---|---|---|---|---|---|
Name |
Solute carrier SLC15A1 (PEPT1)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Intestinal H(+)/peptide cotransporter; Solute carrier family 15 member 1; Oligopeptide transporter, small intestine isoform; PEPT1; Peptide transporter 1
|
||||
Family | Potential-driven transporter (PDT) >> Proton-dependent oligopeptide transporter (POT) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | SLC15A1 | Gene ID | |||
UniProt ID | S15A1_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T91180 | (click to find more therapeutic target data of this DBT) | |||
VARIDT ID | DTD0021 | (click to find more drug transporter data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MGMSKSHSFFGYPLSIFFIVVNEFCERFSYYGMRAILILYFTNFISWDDNLSTAIYHTFV
ALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVTSVSSINDLTDHNHDGTPDSLPV HVVLSLIGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLLSTII TPMLRVQQCGIHSKQACYPLAFGVPAALMAVALIVFVLGSGMYKKFKPQGNIMGKVAKCI GFAIKNRFRHRSKAFPKREHWLDWAKEKYDERLISQIKMVTRVMFLYIPLPMFWALFDQQ GSRWTLQATTMSGKIGALEIQPDQMQTVNAILIVIMVPIFDAVLYPLIAKCGFNFTSLKK MAVGMVLASMAFVVAAIVQVEIDKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVTLGP MSQTNAFMTFDVNKLTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQK PEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQ PNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFEDISANTVNMALQIPQYFLLTCGEVVFSV TGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQFSKQWAEYILFAALLLVVC VIFAIMARFYTYINPAEIEAQFDEDEKKNRLEKSNPYFMSGANSQKQM |
||||
Function |
May constitute a major route for the absorption of protein digestion end-products. Proton-coupled intake of oligopeptides of 2 to 4 amino acids with a preference for dipeptides.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Aceglutamide aluminum | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Other agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | EC50 = 100000 nM (estimated based on the structural similarity with CHEMBL438960 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 0.835616438 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | S15A1_HUMAN | |||||
DIG Name: Alitame | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 310000 nM (estimated based on the structural similarity with CHEMBL441685 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 0.826666667 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | S15A1_HUMAN | |||||
DIG Name: Caldiamide sodium | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsion stabilizing agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | EC50 = 480000 nM (estimated based on the structural similarity with CHEMBL292467 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 0.754716981 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | S15A1_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | Human PEPT1 pharmacophore distinguishes between dipeptide transport and binding. J Med Chem. 2006 Jun 15; 49(12):3636-44. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.