Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET02JIE) | |||||
|---|---|---|---|---|---|
| Name |
Epidermal lipid-binding protein (E-FABP)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Fatty acid-binding protein 5; E-FABP; FABP5; Epidermal-type fatty acid-binding protein; Fatty acid-binding protein, epidermal; PA-FABP; Psoriasis-associated fatty acid-binding protein homolog; FABP5
|
||||
| Family | Other protein families (OPF) >> Fatty acid binding protein (FABP) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | FABP5 | Gene ID | |||
| UniProt ID | FABP5_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T21507 | (click to find more therapeutic target data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTL
KTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVEC VMNNVTCTRIYEKVE |
||||
| Function |
Intracellular carrier for long-chain fatty acids and related active lipids, such as the endocannabinoid, that regulates the metabolism and actions of the ligands they bind. In addition to the cytosolic transport, selectively delivers specific fatty acids from the cytosol to the nucleus, wherein they activate nuclear receptors. Delivers retinoic acid to the nuclear receptor peroxisome proliferator-activated receptor delta; which promotes proliferation and survival.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Palmitic acid | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
 click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; lubricant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 1200 nM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | FABP5_HUMAN | |||||
| DIG Name: Isostearic acid | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Surfactant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 1200 nM (estimated based on the structural similarity with CHEMBL82293 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 0.886363636 | |||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | FABP5_HUMAN | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Discovery of inhibitors of human adipocyte fatty acid-binding protein, a potential type 2 diabetes target. Bioorg Med Chem Lett. 2004 Sep 6; 14(17):4445-8. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.