Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET04NWK) | |||||
---|---|---|---|---|---|
Name |
Anthrax toxin receptor 2 (CMG-2)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Capillary morphogenesis gene 2 protein; CMG-2
|
||||
Family | Other protein families (OPF) >> Anthrax toxin receptor (ATR) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | ANTXR2 | Gene ID | |||
UniProt ID | ANTR2_HUMAN | (click to find more protein-related data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MVAERSPARSPGSWLFPGLWLLVLSGPGGLLRAQEQPSCRRAFDLYFVLDKSGSVANNWI
EIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYI HEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLD FEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQSCTEILELQPSSVCVGEEFQIVLS GRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCPAPILNKAGETLDVSVSFNGG KSVISGSLIVTATECSNGIAAIIVILVLLLLLGIGLMWWFWPLCCKVVIKDPPPPPAPAP KEEEEEPLPTKKWPTVDASYYGGRGVGGIKRMEVRWGDKGSTEEGARLEKAKNAVVKIPE ETEEPIRPRPPRPKPTHQPPQTKWYTPIKGRLDALWALLRRQYDRVSLMRPQEGDEVCIW ECIEKELTA |
||||
Function |
Necessary for cellular interactions with laminin and the extracellular matrix.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Propyl gallate | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Antioxidant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 > 300000 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | ANTR2_HUMAN | |||||
DIG Name: Tannic acid | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 > 300000 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | ANTR2_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | 1,2,3,4,6-Penta-O-galloyl--D-glucopyranose inhibits angiogenesis via inhibition of capillary morphogenesis gene 2. J Med Chem. 2013 Mar 14; 56(5):1940-5. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.