Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET05BSN)
Name
Carbonic anhydrase VI (CA6)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Carbonate dehydratase VI; Carbonic anhydrase VI; CA-VI; Salivary carbonic anhydrase; Secreted carbonic anhydrase; Carbonic anhydrase 6
Family Lyase/isomerase/ligase (L/I/G)  >>  Carbon-oxygen lyase (EC 4.2)
Organism
Homo sapiens (Human)
Gene Name CA6 Gene ID
765
UniProt ID CAH6_HUMAN (click to find more protein-related data of this DBT)
TTD ID T06569 (click to find more therapeutic target data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYN
PSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSE
ISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNF
ISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLS
RTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEIL
DYLRRALN
Function
Its role in saliva is unknown. Reversible hydration of carbon dioxide.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Benzosulfimide Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Flavoring agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 935 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH6_HUMAN
          DIG Name: Tannic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antioxidant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 17800 nM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH6_HUMAN
          DIG Name: Phenol Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 208000 nM (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH6_HUMAN
References
1 Carbonic anhydrase inhibitors. Inhibition studies with anions and sulfonamides of a new cytosolic enzyme from the scleractinian coral Stylophora pistillata. Bioorg Med Chem Lett. 2011 Jan 15; 21(2):710-4.
2 In vitro inhibition of -carbonic anhydrase isozymes by some phenolic compounds. Bioorg Med Chem Lett. 2011 Jul 15; 21(14):4259-62.
3 Carbonic anhydrase inhibitors. Inhibition of mammalian isoforms I-XIV with a series of natural product polyphenols and phenolic acids. Bioorg Med Chem. 2010 Mar 15; 18(6):2159-2164.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.