Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET05GHZ)
Name
Intestinal alkaline phosphatase (IAP)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Intestinal-type alkaline phosphatase; ALPI
Family Hydrolase (HDase)  >>  Ester bond hydrolase (EC 3.1)
Organism
Homo sapiens (Human)
Gene Name ALPI Gene ID
248
UniProt ID PPBI_HUMAN (click to find more protein-related data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLG
DGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLC
GVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYA
HTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADA
SQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRD
PTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERA
GQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVF
NSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHV
MAFAACLEPYTACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAP
Function
Extracellular region, plasma membrane, alkaline phosphatase activity, magnesium ion binding, protease binding, zinc ion binding, dephosphorylation, digestion, phosphatidic acid biosynthetic process
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Phenylalanine Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Solubilizing agent
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 80200 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID PPBI_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 80210 nM (tested by experiment) [2]
                   Tested Species Bos taurus (Bovine)
                   UniProt ID PPBI_BOVIN
          DIG Name: Potassium phosphate monobasic Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Buffering agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 2410 nM (tested by experiment) [3]
                   Tested Species Bos taurus (Bovine)
                   UniProt ID PPBI_BOVIN
References
1 2-Substituted 7-trifluoromethyl-thiadiazolopyrimidones as alkaline phosphatase inhibitors. Synthesis, structure activity relationship and molecular docking study. Eur J Med Chem. 2018 Jan 20; 144:116-127.
2 Synthesis, alkaline phosphatase inhibition studies and molecular docking of novel derivatives of 4-quinolones. Eur J Med Chem. 2017 Jan 27; 126:408-420.
3 Synthesis, crystal structure and biological evaluation of some novel 1,2,4-triazolo[3,4-b]-1,3,4-thiadiazoles and 1,2,4-triazolo[3,4-b]-1,3,4-thiadiazines. Eur J Med Chem. 2014 May 6; 78:167-77.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.