Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET06CRH) | |||||
---|---|---|---|---|---|
Name |
Choline acetylase (CHAT)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Choline O-acetyltransferase; CHOACTase; ChAT
|
||||
Family | Transferase (TFase) >> Acyltransferase (EC 2.3) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | CHAT | Gene ID | |||
UniProt ID | CLAT_HUMAN | (click to find more protein-related data of this DBT) | |||
INTEDE ID | DME0102 | (click to find more drug-metabolizing enzyme data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MGLRTAKKRGLGGGGKWKREEGGGTRGRREVRPACFLQSGGRGDPGDVGGPAGNPGCSPH
PRAATRPPPLPAHTPAHTPEWCGAASAEAAEPRRAGPHLCIPAPGLTKTPILEKVPRKMA AKTPSSEESGLPKLPVPPLQQTLATYLQCMRHLVSEEQFRKSQAIVQQFGAPGGLGETLQ QKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFPGTDDQLRFAASLIS GVLSYKALLDSHSIPTDCAKGQLSGQPLCMKQYYGLFSSYRLPGHTQDTLVAQNSSIMPE PEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSE WAEARTVLVKDSTNRDSLDMIERCICLVCLDAPGGVELSDTHRALQLLHGGGYSKNGANR WYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHVTQSSRKLIRADSVSELPAP RRLRWKCSPEIQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVALQ LAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALAFVRAVTDHKAAVPASEKLLLL KDAIRAQTAYTVMAITGMAIDNHLLALRELARAMCKELPEMFMDETYLMSNRFVLSTSQV PTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRD LCSLLPPTESKPLATKEKATRPSQGHQP |
||||
Function |
Catalyzes the reversible synthesis of acetylcholine (ACh) from acetyl CoA and choline at cholinergic synapses.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Acrylic acid | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Other agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 < 200000 nM (tested by experiment) | [1] | ||||
Tested Species | Rattus norvegicus (Rat) | |||||
UniProt ID | CLAT_RAT | |||||
DIG Name: Trolamine | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Alkalizing agent; Emulsifying agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 < 200000 nM (estimated based on the structural similarity with CHEMBL1135 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 0.896551724 | |||||
Tested Species | Rattus norvegicus (Rat) | |||||
UniProt ID | CLAT_RAT | |||||
References | |||||
---|---|---|---|---|---|
1 | Chemistry and biological activities of N,N-dimethylaminoethyl acrylate, a choline acetyltransferase inhibitor. J Med Chem. 1976 Feb; 19(2):300-3. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.