Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET06JLP)
Name
Lactoylglutathione lyase (GLO1)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Aldoketomutase; GLO1; Glx I; GlxI; Glyoxalase I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase
Family Lyase/isomerase/ligase (L/I/G)  >>  Carbon-sulfur lyase (EC 4.4)
Organism
Homo sapiens (Human)
Gene Name GLO1 Gene ID
2739
UniProt ID LGUL_HUMAN (click to find more protein-related data of this DBT)
TTD ID T88285 (click to find more therapeutic target data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQK
CDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNS
DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKM
ATLM
Function
Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione. Involved in the regulation of TNF-induced transcriptional activity of NF- kappa-B. Required for normal osteoclastogenesis.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Maltol Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Flavoring agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 223872.11 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID LGUL_HUMAN
References
1 The hypothetical active site lattice. An approach to modelling active sites from data on inhibitor molecules. J Med Chem. 1988 Jul; 31(7):1396-406.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.