Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET06OZV)
Name
S1P receptor 1 (S1PR1)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Sphingosine 1-phosphate receptor 1; S1P receptor Edg-1; S1P1; CD363; Endothelial differentiation G-protein coupled receptor 1; Sphingosine 1-phosphate receptor Edg-1
Family G-protein coupled receptor (GPCR)  >>  G-protein coupled rhodopsin receptor (GPCR-A)
Organism
Homo sapiens (Human)
Gene Name S1PR1 Gene ID
1901
UniProt ID S1PR1_HUMAN (click to find more protein-related data of this DBT)
TTD ID T13852 (click to find more therapeutic target data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
Function
G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P) that seems to be coupled to the G(i) subclass of heteromeric G proteins. Signaling leads to the activation of RAC1, SRC, PTK2/FAK1 and MAP kinases. Plays an important role in cell migration, probably via its role in the reorganization of the actin cytoskeleton and the formation of lamellipodia in response to stimuli that increase the activity of the sphingosine kinase SPHK1.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Delfen Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 33 nM (estimated based on the structural similarity with CHEMBL228137 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.894736842
                   Tested Species Homo sapiens (Human)
                   UniProt ID S1PR1_HUMAN
References
1 Synthesis and biological evaluation of gamma-aminophosphonates as potent, subtype-selective sphingosine 1-phosphate receptor agonists and antagonists. Bioorg Med Chem. 2007 Jan 15; 15(2):663-77.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.