Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET09UIC)
Name
D-amino acid oxidase (DAAO)
Synonyms    Click to Show/Hide the Synonyms of This DBT
D-amino oxidase; DAMOX; DAAO; DAO
Family Oxidoreductase (ORase)  >>  CH-NH2 donor oxidoreductase (EC 1.4)
Organism
Homo sapiens (Human)
Gene Name DAO Gene ID
1610
UniProt ID OXDA_HUMAN (click to find more protein-related data of this DBT)
TTD ID T33124 (click to find more therapeutic target data of this DBT)
INTEDE ID DME0565 (click to find more drug-metabolizing enzyme data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPN
NPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPR
ELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN
CTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGG
IFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGP
SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL
Function
Regulates the level of the neuromodulator D-serine in the brain. Has high activity towards D-DOPA and contributes to dopamine synthesis. Could act as a detoxifying agent which removes D-amino acids accumulated during aging. Acts on a variety of D-amino acids with a preference for those having small hydrophobic side chains followed by those bearing polar, aromatic, and basic groups. Does not act on acidic amino acids.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Benzoic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 2000 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID OXDA_HUMAN
          DIG Name: Maleic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Acidulant; Buffering agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 357000 nM (estimated based on the structural similarity with CHEMBL1213528 ) [2]
                   Structural Similarity Tanimoto coefficient = 0.911764706
                   Tested Species Homo sapiens (Human)
                   UniProt ID OXDA_HUMAN
          DIG Name: Potassium benzoate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 46900 nM (estimated based on the structural similarity with CHEMBL541 ) [2]
                   Structural Similarity Tanimoto coefficient = 0.941860465
                   Tested Species Homo sapiens (Human)
                   UniProt ID OXDA_HUMAN
References
1 Structural, kinetic, and pharmacodynamic mechanisms of D-amino acid oxidase inhibition by small molecules. J Med Chem. 2013 May 9; 56(9):3710-24.
2 Identification of novel D-amino acid oxidase inhibitors by in silico screening and their functional characterization in vitro. J Med Chem. 2013 Mar 14; 56(5):1894-907.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.