Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0A8DA)
Name
Acylsphingosine deacylase NAAA (ASAHL)
Synonyms    Click to Show/Hide the Synonyms of This DBT
ASAH-like protein; ASAHlike protein; Acid ceramidase-like protein; Acid ceramidaselike protein; Acylsphingosine deacylase NAAA; N-acylethanolamine-hydrolyzing acidamidase; N-acylsphingosine amidohydrolase-like; NAAA; Nacylethanolaminehydrolyzing acid amidase subunit beta; Nacylsphingosine amidohydrolaselike; ASAHL; PLT
Family Hydrolase (HDase)  >>  Carbon-nitrogen hydrolase (EC 3.5)
Organism
Homo sapiens (Human)
Gene Name NAAA Gene ID
27163
UniProt ID NAAA_HUMAN (click to find more protein-related data of this DBT)
TTD ID T78326 (click to find more therapeutic target data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MRTADREARPGLPSLLLLLLAGAGLSAASPPAAPRFNVSLDSVPELRWLPVLRHYDLDLV
RAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCDFMNLSLADCLLVNLAY
ESSVFCTSIVAQDSRGHIYHGRNLDYPFGNVLRKLTVDVQFLKNGQIAFTGTTFIGYVGL
WTGQSPHKFTVSGDERDKGWWWENAIAALFRRHIPVSWLIRATLSESENFEAAVGKLAKT
PLIADVYYIVGGTSPREGVVITRNRDGPADIWPLDPLNGAWFRVETNYDHWKPAPKEDDR
RTSAIKALNATGQANLSLEALFQILSVVPVYNNFTIYTTVMSAGSPDKYMTRIRNPSRK
Function
Degrades bioactive fatty acid amides to their corresponding acids, with the following preference: N- palmitoylethanolamine > N-myristoylethanolamine > N- lauroylethanolamine = N-stearoylethanolamine > N- arachidonoylethanolamine > N-oleoylethanolamine. Also exhibits weak hydrolytic activity against the ceramides N- lauroylsphingosine and N-palmitoylsphingosine.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Isopropyl palmitate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emollient; Oleaginous vehicle; Penetration agent; Solvent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 19000 nM (estimated based on the structural similarity with CHEMBL139056 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.954545455
                   Tested Species Homo sapiens (Human)
                   UniProt ID NAAA_HUMAN
References
1 The endocannabinoid system: drug targets, lead compounds, and potential therapeutic applications. J Med Chem. 2005 Aug 11; 48(16):5059-87.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.