Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0A8RI) | |||||
---|---|---|---|---|---|
Name |
Dehydrogenase/reductase 9C 3 (11-DH2)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Corticosteroid 11-beta-dehydrogenase 2; 11 beta-HSD2; 11 beta-hydroxysteroid dehydrogenase type 2; 11-DH2; 11-HSD type II; 11-beta-HSD; 11-beta-HSD type II; 11-beta-HSD2; 11-beta-hydroxysteroid dehydrogenase type 2; 11-beta-hydroxysteroid dehydrogenase type II; HSD11B2; NAD-dependent 11-beta-hydroxysteroid dehydrogenase; Short chain dehydrogenase/reductase family 9C member 3
|
||||
Family | Oxidoreductase (ORase) >> CH-OH donor oxidoreductase (EC 1.1) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | HSD11B2 | Gene ID | |||
UniProt ID | DHI2_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T43721 | (click to find more therapeutic target data of this DBT) | |||
INTEDE ID | DME0419 | (click to find more drug-metabolizing enzyme data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAV
LAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPG AIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELS PVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVA LLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYI EHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRR RFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR |
||||
Function |
Catalyzes the conversion of cortisol to the inactive metabolite cortisone. modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Monoammonium glycyrrhizate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Flavoring agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 0.4 nM (estimated based on the structural similarity with CHEMBL441687 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 0.982905983 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | DHI2_HUMAN | |||||
DIG Name: Glycyrrhizin | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 0.4 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | DHI2_HUMAN | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.