Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0AB9D) | |||||
|---|---|---|---|---|---|
| Name |
Trace amine receptor 1 (TAAR1)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Trace amine-associated receptor 1; TaR-1
|
||||
| Family | G-protein coupled receptor (GPCR) >> G-protein coupled rhodopsin receptor (GPCR-A) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | TAAR1 | Gene ID | |||
| UniProt ID | TAAR1_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T99524 | (click to find more therapeutic target data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNW
LIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISID RYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRG GCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNG ISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFN PMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS |
||||
| Function |
Receptor for trace amines, including beta-phenylethylamine (b-PEA), p-tyramine (p-TYR), octopamine and tryptamine, with highest affinity for b-PEA and p-TYR. Unresponsive to classical biogenic amines, such as epinephrine and histamine and only partially activated by dopamine and serotonin. Trace amines are biogenic amines present in very low levels in mammalian tissues. Although some trace amines have clearly defined roles as neurotransmitters in invertebrates, the extent to which they function as true neurotransmitters in vertebrates has remained speculative.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: O-tolyl biguanide | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 = 1700 nM (estimated based on the structural similarity with CHEMBL291064 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 0.954022989 | |||||
| Tested Species | Mus musculus (Mouse) | |||||
| UniProt ID | TAAR1_MOUSE | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Novel biguanide-based derivatives scouted as TAAR1 agonists: Synthesis, biological evaluation, ADME prediction and molecular docking studies. Eur J Med Chem. 2017 Feb 15; 127:781-792. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

