Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0AX5F)
Name
Dehydrogenase/reductase 26C 1 (11-DH)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Corticosteroid 11-beta-dehydrogenase 1; 11 beta-hydroxysteroid dehydrogenase type 1; 11-DH; 11-beta-HSD1; 11-beta-hydroxysteroid dehydrogenase 1; 11HSD1; 11beta-HSD1A; HSD11B1; Short chain dehydrogenase/reductase family 26C member 1
Family Oxidoreductase (ORase)  >>  CH-OH donor oxidoreductase (EC 1.1)
Organism
Homo sapiens (Human)
Gene Name HSD11B1 Gene ID
3290
UniProt ID DHI1_HUMAN (click to find more protein-related data of this DBT)
TTD ID T65200 (click to find more therapeutic target data of this DBT)
INTEDE ID DME0199 (click to find more drug-metabolizing enzyme data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAH
VVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNH
ITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMV
AAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEE
CALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
Function
Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Monoammonium glycyrrhizate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Flavoring agent
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 10 nM (estimated based on the structural similarity with CHEMBL441687 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.982905983
                   Tested Species Homo sapiens (Human)
                   UniProt ID DHI1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 8 nM (estimated based on the structural similarity with CHEMBL441687 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.982905983
                   Tested Species Mus musculus (Mouse)
                   UniProt ID DHI1_MOUSE
          DIG Name: Glycyrrhizin Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Flavoring agent
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 6 nM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID DHI1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 3 nM (tested by experiment) [2]
                   Tested Species Mus musculus (Mouse)
                   UniProt ID DHI1_MOUSE
References
1 Synthesis and evaluation of piperidine urea derivatives as efficacious 11-hydroxysteroid dehydrogenase type 1 inhibitors in diabetic ob/ob mice. Bioorg Med Chem Lett. 2012 Apr 15; 22(8):2748-52.
2 Cycloartane and friedelane triterpenoids from the leaves of Caloncoba glauca and their evaluation for inhibition of 11-hydroxysteroid dehydrogenases. J Nat Prod. 2012 Apr 27; 75(4):599-604.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.