Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0EN3R) | |||||
---|---|---|---|---|---|
Name |
Catechol O-methyltransferase (COMT)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Catechol O-methyltransferase; COMT
|
||||
Family | Cation-dependent O-methyltransferase >> Methylase (EC 2.1) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | COMT | Gene ID | |||
UniProt ID | COMT_HUMAN | (click to find more protein-related data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRIL
NHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCG YSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKY DVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFE CTHYQSFLEYREVVDGLEKAIYKGPGSEAGP |
||||
Function |
Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Propyl gallate | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Antioxidant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 0.015 uM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | COMT_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | The activities of drug inactive ingredients on biological targets. Science. 2020 Jul 24;369(6502):403-413. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.