Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0EN9M) | |||||
---|---|---|---|---|---|
Name |
Casein kinase II alpha (CSNK2A1)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Casein kinase II subunit alpha; Protein kinase CK2; CK II; CK II alpha; CK2A1
|
||||
Family | Transferase (TFase) >> Kinase (EC 2.7) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | CSNK2A1 | Gene ID | |||
UniProt ID | CSK21_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T51565 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPT PSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ |
||||
Function |
Regulates numerous cellular processes, such as cell cycle progression, apoptosis and transcription, as well as viral infection. May act as a regulatory node which integrates and coordinates numerous signals leading to an appropriate cellular response. During mitosis, functions as a component of the p53/TP53-dependent spindle assembly checkpoint (SAC) that maintains cyclin-B-CDK1 activity and G2 arrest in response to spindle damage.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Naphthol yellow S | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 400 nM (estimated based on the structural similarity with CHEMBL459510 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 0.788888889 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | CSK21_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | Novel non-ATP competitive small molecules targeting the CK2 / interface. Bioorg Med Chem. 2018 Jul 15; 26(11):3016-3020. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.