Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0EY7A) | |||||
---|---|---|---|---|---|
Name |
Aromatase (ARO1)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Estrogen synthase; Estrogen synthetase; Cytochrome P-450AROM; Cytochrome P450 19A1; CYAR; CYP19; CYPXIX; CYP19A1; P-450AROM
|
||||
Family | Oxidoreductase (ORase) >> Oxygen paired donor oxidoreductase (EC 1.14) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | CYP19A1 | Gene ID | |||
UniProt ID | CP19A_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T13260 | (click to find more therapeutic target data of this DBT) | |||
INTEDE ID | DME0002 | (click to find more drug-metabolizing enzyme data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLI
SHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN ESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWL YKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCI LEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFI YESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLH PDETKNMLEMIFTPRNSDRCLEH |
||||
Function |
Catalyzes the formation of aromatic C18 estrogens from C19 androgens.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Oleic acid | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; Solubilizing agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 32700 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | CP19A_HUMAN | |||||
DIG Name: Linoleic acid | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; Solubilizing agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 48000 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | CP19A_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | Interference by naturally occurring fatty acids in a noncellular enzyme-based aromatase bioassay. J Nat Prod. 2006 Apr; 69(4):700-3. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.