Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0FI9W)
Name
Heart lipid-binding protein (H-FABP)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Fatty acid-binding protein 3; H-FABP; Heart-type fatty acid-binding protein; M-FABP; MDGI; Mammary-derived growth inhibitor; Muscle fatty acid-binding protein; Fatty acid-binding protein, heart; FABP3
Family Other protein families (OPF)  >>  Fatty acid binding protein (FABP)
Organism
Homo sapiens (Human)
Gene Name FABP3 Gene ID
2170
UniProt ID FABPH_HUMAN (click to find more protein-related data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
GTAVCTRTYEKEA
Function
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Palmitic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 2600 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID FABPH_HUMAN
          DIG Name: Linoleic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; Solubilizing agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 1000 nM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID FABPH_HUMAN
References
1 Discovery of inhibitors of human adipocyte fatty acid-binding protein, a potential type 2 diabetes target. Bioorg Med Chem Lett. 2004 Sep 6; 14(17):4445-8.
2 Novel fatty acid binding protein 4 (FABP4) inhibitors: virtual screening, synthesis and crystal structure determination. Eur J Med Chem. 2015 Jan 27; 90:241-50.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.