Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0IX1X)
Name
Caspase-3 (CASP3)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Apopain; CASP-3; CPP-32; CPP32; Caspase 3; Cysteine protease CPP32; Protein Yama; SCA-1; SREBP cleavage activity 1; Yama protein
Family Hydrolase (HDase)  >>  Peptidase (EC 3.4)
Organism
Homo sapiens (Human)
Gene Name CASP3 Gene ID
836
UniProt ID CASP3_HUMAN (click to find more protein-related data of this DBT)
TTD ID T57943 (click to find more therapeutic target data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTG
MTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLS
HGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDD
DMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVN
RKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Function
At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Involved in the cleavage of huntingtin. Triggers cell adhesion in sympathetic neurons through RET cleavage. Involved in the activation cascade of caspases responsible for apoptosis execution.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: FD&C yellow no. 5 free acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 100000 nM (estimated based on the structural similarity with CHEMBL3145148 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.797101449
                   Tested Species Homo sapiens (Human)
                   UniProt ID CASP3_HUMAN
References
1 PubChem BioAssay data set.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.