Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0M9ET)
Name
Adipocyte lipid-binding protein (ALBP)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Fatty acid-binding protein 4; Adipocyte fatty binding protein; Adipocyte fatty-acid-binding protein; Adipocyte-type fatty acid-binding protein; Fatty acid-binding protein 4; Fatty acid-binding protein, adipocyte; A-FABP; AFABP; ALBP; FABP4
Family Other protein families (OPF)  >>  Fatty acid binding protein (FABP)
Organism
Homo sapiens (Human)
Gene Name FABP4 Gene ID
2167
UniProt ID FABP4_HUMAN (click to find more protein-related data of this DBT)
TTD ID T07217 (click to find more therapeutic target data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA
Function
Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus. Lipid transport protein in adipocytes.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Oleic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; Solubilizing agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 1500 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID FABP4_HUMAN
          DIG Name: Palmitic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 930 nM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID FABP4_HUMAN
          DIG Name: Linoleic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; Solubilizing agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 1000 nM (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID FABP4_HUMAN
References
1 The discovery of novel and selective fatty acid binding protein 4 inhibitors by virtual screening and biological evaluation. Bioorg Med Chem. 2016 Sep 15; 24(18):4310-4317.
2 Discovery of inhibitors of human adipocyte fatty acid-binding protein, a potential type 2 diabetes target. Bioorg Med Chem Lett. 2004 Sep 6; 14(17):4445-8.
3 Discovery of highly selective inhibitors of human fatty acid binding protein 4 (FABP4) by virtual screening. Bioorg Med Chem Lett. 2010 Jun 15; 20(12):3675-9.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.