Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0OS9A)
Name
Deacetylase sirtuin-5 (SIRT5)
Synonyms    Click to Show/Hide the Synonyms of This DBT
NAD-dependent deacetylase sirtuin-5; NAD-dependent protein deacetylase sirtuin-5; Regulatory protein SIR2 homolog 5; SIR2-like protein 5; SIR2L5
Family Transferase (TFase)  >>  Acyltransferase (EC 2.3)
Organism
Homo sapiens (Human)
Gene Name SIRT5 Gene ID
23408
UniProt ID SIR5_HUMAN (click to find more protein-related data of this DBT)
TTD ID T91940 (click to find more therapeutic target data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAG
VSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRA
IAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPI
CPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELA
HCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEA
LACHENETVS
Function
NAD-dependent lysine demalonylase, desuccinylase and deglutarylase that specifically removes malonyl, succinyl and glutaryl groups on target proteins. Activates CPS1 and contributes to the regulation of blood ammonia levels during prolonged fasting: acts by mediating desuccinylation and deglutarylation of CPS1, thereby increasing CPS1 activity in response to elevated NAD levels during fasting. Activates SOD1 by mediating its desuccinylation, leading to reduced reactive oxygen species.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Niacinamide Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antioxidant; Solubilizing agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 > 100000 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SIR5_HUMAN
References
1 A FRET-based assay for screening SIRT5 specific modulators. Bioorg Med Chem Lett. 2015 Apr 15; 25(8):1671-1674.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.