Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0P7MH)
Name
Matrix metalloproteinase-2 (MMP2)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Gelatinase A; MMP-2; Matrix metalloproteinase 2; 72 kDa gelatinase; 72 kDa type IV collagenase; CLG4A; Matrix metalloproteinase-2; TBE-1
Family Hydrolase (HDase)  >>  Peptidase (EC 3.4)
Organism
Homo sapiens (Human)
Gene Name MMP2 Gene ID
4313
UniProt ID MMP2_HUMAN (click to find more protein-related data of this DBT)
TTD ID T68251 (click to find more therapeutic target data of this DBT)
INTEDE ID DME0561 (click to find more drug-metabolizing enzyme data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT
SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQ
IRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEY
WIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
GFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Function
As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly-|-Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Involved in the formation of the fibrovascular tissues in association with MMP14. Ubiquitinous metalloproteinase that is involved in diverse functions.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Chlorhexidine Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 7630 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID MMP2_HUMAN
          DIG Name: Neotame Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Flavoring agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 10.96 nM (estimated based on the structural similarity with CHEMBL152805 ) [2]
                   Structural Similarity Tanimoto coefficient = 0.918032787
                   Tested Species Homo sapiens (Human)
                   UniProt ID MMP2_HUMAN
References
1 Identification of potential and selective collagenase, gelatinase inhibitors from Crataegus pinnatifida. Bioorg Med Chem Lett. 2010 Feb 1; 20(3):991-3.
2 Matrix metalloproteinases (MMPs): chemical-biological functions and (Q)SARs. Bioorg Med Chem. 2007 Mar 15; 15(6):2223-68.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.