Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0PT9B)
Name
Deacetylase sirtuin-3 (SIRT3)
Synonyms    Click to Show/Hide the Synonyms of This DBT
NAD-dependent deacetylase sirtuin-3; NAD-dependent protein deacetylase sirtuin-3; Regulatory protein SIR2 homolog 3; SIR2-like protein 3; SIR2L3; hSIRT3
Family Transferase (TFase)  >>  Acyltransferase (EC 2.3)
Organism
Homo sapiens (Human)
Gene Name SIRT3 Gene ID
23410
UniProt ID SIR3_HUMAN (click to find more protein-related data of this DBT)
TTD ID T91959 (click to find more therapeutic target data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MAFWGWRAAAALRLWGRVVERVEAGGGVGPFQACGCRLVLGGRDDVSAGLRGSHGARGEP
LDPARPLQRPPRPEVPRAFRRQPRAAAPSFFFSSIKGGRRSISFSVGASSVVGSGGSSDK
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIF
ELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIP
ASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQ
RFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDV
AQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Function
NAD-dependent protein deacetylase. Activates or deactivates mitochondrial target proteins by deacetylating key lysine residues. Known targets include ACSS1, IDH, GDH, SOD2, PDHA1, LCAD, SDHA and the ATP synthase subunit ATP5PO. Contributes to the regulation of the cellular energy metabolism. Important for regulating tissue-specific ATP levels. In response to metabolic stress, deacetylates transcription factor FOXO3 and recruits FOXO3 and mitochondrial RNA polymerase POLRMT to mtDNA to promote mtDNA transcription.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Niacinamide Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antioxidant; Solubilizing agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 6200 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SIR3_HUMAN
References
1 Discovery of potent and selective sirtuin 2 (SIRT2) inhibitors using a fragment-based approach. J Med Chem. 2014 Oct 23; 57(20):8340-57.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.